ALG1 anticorps (N-Term)
-
- Antigène Voir toutes ALG1 Anticorps
- ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALG1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALG1 antibody was raised against the N terminal of ALG1
- Purification
- Affinity purified
- Immunogène
- ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG
- Top Product
- Discover our top product ALG1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALG1 Blocking Peptide, catalog no. 33R-9885, is also available for use as a blocking control in assays to test for specificity of this ALG1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALG1 (Chitobiosyldiphosphodolichol beta-Mannosyltransferase (ALG1))
- Autre désignation
- ALG1 (ALG1 Produits)
- Synonymes
- anticorps CDG1K, anticorps HMAT1, anticorps HMT-1, anticorps HMT1, anticorps MT-1, anticorps Mat-1, anticorps hMat-1, anticorps zgc:66221, anticorps wu:fi34b12, anticorps alg1, anticorps hmat1, anticorps hmt1, anticorps ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase, anticorps asparagine-linked glycosylation 1 (beta-1,4-mannosyltransferase), anticorps Beta-mannosyltransferase, anticorps ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase L homeolog, anticorps ALG1, anticorps Alg1, anticorps alg1, anticorps alg1.L
- Sujet
- ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K).
- Poids moléculaire
- 52 kDa (MW of target protein)
-