SLC22A13 anticorps (N-Term)

N° du produit ABIN635939

Détail du produit anti-SLC22A13 anticorps

Antigène: SLC22A13 (Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC22A13 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC22 A13 antibody was raised against the N terminal of SLC22 13

Purification: Affinity purified

Immunogène: SLC22 A13 antibody was raised using the N terminal of SLC22 13 corresponding to a region with amino acids FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC22A13 Blocking Peptide, catalog no. 33R-2884, is also available for use as a blocking control in assays to test for specificity of this SLC22A13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC22A13

Antigène: SLC22A13 (Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13))

Autre désignation: SLC22A13 (SLC22A13 Produits)

Synonymes: anticorps OAT10, anticorps OCTL1, anticorps OCTL3, anticorps ORCTL-3, anticorps ORCTL3, anticorps AI648912, anticorps solute carrier family 22 member 13, anticorps solute carrier family 22 (organic cation transporter), member 13, anticorps SLC22A13, anticorps Slc22a13

Sujet: SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine.

Poids moléculaire: 61 kDa (MW of target protein)