SLC22A12 anticorps
-
- Antigène Voir toutes SLC22A12 Anticorps
- SLC22A12 (Solute Carrier Family 22 (Organic Anion/urate Transporter), Member 12 (SLC22A12))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A12 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC22 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR
- Top Product
- Discover our top product SLC22A12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A12 Blocking Peptide, catalog no. 33R-8641, is also available for use as a blocking control in assays to test for specificity of this SLC22A12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A12 (Solute Carrier Family 22 (Organic Anion/urate Transporter), Member 12 (SLC22A12))
- Autre désignation
- SLC22A12 (SLC22A12 Produits)
- Synonymes
- anticorps AI987855, anticorps OAT4L, anticorps Rst, anticorps Slc22al2, anticorps URAT1, anticorps RST, anticorps solute carrier family 22 (organic anion/cation transporter), member 12, anticorps solute carrier family 22 member 12, anticorps Slc22a12, anticorps SLC22A12
- Sujet
- SLC22A12 is required for efficient urate re-absorption in the kidney. SLC22A12 regulates blood urate levels. SLC22A12 mediates saturable urate uptake by facilitating the exchange of urate against organic anions.
- Poids moléculaire
- 59 kDa (MW of target protein)
-