DHRS7B anticorps
-
- Antigène Voir toutes DHRS7B Anticorps
- DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DHRS7B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DHRS7 B antibody was raised using a synthetic peptide corresponding to a region with amino acids QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA
- Top Product
- Discover our top product DHRS7B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DHRS7B Blocking Peptide, catalog no. 33R-7459, is also available for use as a blocking control in assays to test for specificity of this DHRS7B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHRS0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DHRS7B (Dehydrogenase/reductase (SDR Family) Member 7B (DHRS7B))
- Autre désignation
- DHRS7B (DHRS7B Produits)
- Synonymes
- anticorps MGC146711, anticorps SDR32C1, anticorps BC003479, anticorps C79874, anticorps C80074, anticorps PexRAP, anticorps RGD1311243, anticorps zgc:112518, anticorps dehydrogenase/reductase 7B, anticorps dehydrogenase/reductase (SDR family) member 7B, anticorps dehydrogenase/reductase (SDR family) member 7B L homeolog, anticorps DHRS7B, anticorps dhrs7b, anticorps Dhrs7b, anticorps dhrs7b.L
- Sujet
- This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function.
- Poids moléculaire
- 35 kDa (MW of target protein)
-