CRISPLD2 anticorps (N-Term)
-
- Antigène Voir toutes CRISPLD2 Anticorps
- CRISPLD2 (Cysteine-Rich Secretory Protein LCCL Domain Containing 2 (CRISPLD2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRISPLD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CRISPLD2 antibody was raised against the N terminal of CRISPLD2
- Purification
- Affinity purified
- Immunogène
- CRISPLD2 antibody was raised using the N terminal of CRISPLD2 corresponding to a region with amino acids MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA
- Top Product
- Discover our top product CRISPLD2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CRISPLD2 Blocking Peptide, catalog no. 33R-6404, is also available for use as a blocking control in assays to test for specificity of this CRISPLD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRISPLD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRISPLD2 (Cysteine-Rich Secretory Protein LCCL Domain Containing 2 (CRISPLD2))
- Autre désignation
- CRISPLD2 (CRISPLD2 Produits)
- Synonymes
- anticorps MGC107747, anticorps CRISP11, anticorps LCRISP2, anticorps 1810049K24Rik, anticorps Lcrisp2, anticorps Lgl1, anticorps coffeecrisp, anticorps cysteine rich secretory protein LCCL domain containing 2, anticorps cysteine-rich secretory protein LCCL domain containing 2, anticorps CRISPLD2, anticorps crispld2, anticorps Crispld2
- Sujet
- CRISPLD2 is a novel NSCLP candidate gene.
- Poids moléculaire
- 56 kDa (MW of target protein)
-