HSD11B1 anticorps
-
- Antigène Voir toutes HSD11B1 Anticorps
- HSD11B1 (Hydroxysteroid (11-Beta) Dehydrogenase 1 (HSD11B1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HSD11B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HSD11 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
- Top Product
- Discover our top product HSD11B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HSD11B1 Blocking Peptide, catalog no. 33R-7614, is also available for use as a blocking control in assays to test for specificity of this HSD11B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HSD11B1 (Hydroxysteroid (11-Beta) Dehydrogenase 1 (HSD11B1))
- Autre désignation
- HSD11B1 (HSD11B1 Produits)
- Synonymes
- anticorps 11-DH, anticorps 11-beta-HSD1, anticorps CORTRD2, anticorps HDL, anticorps HSD11, anticorps HSD11B, anticorps HSD11L, anticorps SDR26C1, anticorps hsd11, anticorps hsd11b, anticorps LRRGT00065, anticorps hydroxysteroid 11-beta dehydrogenase 1, anticorps hydroxysteroid (11-beta) dehydrogenase 1b, anticorps hydroxysteroid (11-beta) dehydrogenase 1 L homeolog, anticorps HSD11B1, anticorps HSD11B1b, anticorps hsd11b1.L, anticorps Hsd11b1
- Sujet
- HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.
- Poids moléculaire
- 32 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Carbohydrate Metabolic Process
-