HSD11B1 anticorps

N° du produit ABIN636041

Détail du produit anti-HSD11B1 anticorps

Antigène: HSD11B1 (Hydroxysteroid (11-Beta) Dehydrogenase 1 (HSD11B1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSD11B1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HSD11 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSD11B1 Blocking Peptide, catalog no. 33R-7614, is also available for use as a blocking control in assays to test for specificity of this HSD11B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSD11B1

Antigène: HSD11B1 (Hydroxysteroid (11-Beta) Dehydrogenase 1 (HSD11B1))

Autre désignation: HSD11B1 (HSD11B1 Produits)

Synonymes: anticorps 11-DH, anticorps 11-beta-HSD1, anticorps CORTRD2, anticorps HDL, anticorps HSD11, anticorps HSD11B, anticorps HSD11L, anticorps SDR26C1, anticorps hsd11, anticorps hsd11b, anticorps LRRGT00065, anticorps hydroxysteroid 11-beta dehydrogenase 1, anticorps hydroxysteroid (11-beta) dehydrogenase 1b, anticorps hydroxysteroid (11-beta) dehydrogenase 1 L homeolog, anticorps HSD11B1, anticorps HSD11B1b, anticorps hsd11b1.L, anticorps Hsd11b1

Sujet: HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Regulation of Carbohydrate Metabolic Process