ST6GALNAC1 anticorps

N° du produit ABIN636045

Détail du produit anti-ST6GALNAC1 anticorps

Antigène: ST6GALNAC1 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 1 (ST6GALNAC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST6GALNAC1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ST6 GALNAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST6GALNAC1 Blocking Peptide, catalog no. 33R-5049, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST6GALNAC1

Antigène: ST6GALNAC1 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 1 (ST6GALNAC1))

Autre désignation: ST6GALNAC1 (ST6GALNAC1 Produits)

Synonymes: anticorps HSY11339, anticorps SIAT7A, anticorps ST6GalNAcI, anticorps STYI, anticorps Siat7a, anticorps Siat7A, anticorps ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1, anticorps ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1, anticorps ST6GALNAC1, anticorps St6galnac1

Sujet: Glycosylation of proteins affects cell-cell interaction, interactions with the matrix, and the functions of intracellular molecules. ST6GALNAC1 transfers a sialic acid, N-acetylneuraminic acid (NeuAc), in an alpha-2,6 linkage to O-linked GalNAc residues. The cancer-associated sialyl-Tn (sTn) antigen is formed by ST6GALNAC1-catalyzed sialylation of GalNAc residues on mucins.

Poids moléculaire: 68 kDa (MW of target protein)