ACVR1C/ALK7 anticorps (N-Term)
-
- Antigène Voir toutes ACVR1C/ALK7 (ACVR1C) Anticorps
- ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACVR1C/ALK7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACVR1 C antibody was raised against the N terminal of ACVR1
- Purification
- Affinity purified
- Immunogène
- ACVR1 C antibody was raised using the N terminal of ACVR1 corresponding to a region with amino acids QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP
- Top Product
- Discover our top product ACVR1C Anticorps primaire
-
anti-Activin Receptor Type 1C (ACVR1C) (AA 22-113) antibody
ACVR1C Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (AA 21-120) antibodyACVR1C Reactivité: Humain, Souris, Rat WB, ELISA, FACS, IHC (p), IF (cc), IF (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (AA 33-62), (N-Term) antibodyACVR1C Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB8195 unconjugated
anti-Activin Receptor Type 1C (ACVR1C) antibodyACVR1C Reactivité: Humain, Souris, Rat IHC Hôte: Lapin Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (Internal Region) antibodyACVR1C Reactivité: Humain, Boeuf (Vache), Porc, Roussette (Chauve-souris) IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (N-Term) antibodyACVR1C Reactivité: Humain, Souris, Rat WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) antibodyACVR1C Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (Center) antibodyACVR1C Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (C-Term) antibodyACVR1C Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Activin Receptor Type 1C (ACVR1C) (AA 21-493) antibodyACVR1C Reactivité: Humain WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACVR1C Blocking Peptide, catalog no. 33R-7772, is also available for use as a blocking control in assays to test for specificity of this ACVR1C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACVR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACVR1C/ALK7 (ACVR1C) (Activin Receptor Type 1C (ACVR1C))
- Autre désignation
- ACVR1C (ACVR1C Produits)
- Synonymes
- anticorps ACVRLK7, anticorps ALK7, anticorps Alk-7, anticorps C230097P10, anticorps Alk7, anticorps habrec1, anticorps activin A receptor type 1C, anticorps activin A receptor, type IC, anticorps ACVR1C, anticorps Acvr1c
- Sujet
- ACVR1C is a type I receptor for the TGFB family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors.
- Poids moléculaire
- 55 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, Positive Regulation of Endopeptidase Activity
-
