CYP3A7 anticorps (Middle Region)
-
- Antigène Voir toutes CYP3A7 Anticorps
- CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP3A7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP3 A7 antibody was raised against the middle region of CYP3 7
- Purification
- Affinity purified
- Immunogène
- CYP3 A7 antibody was raised using the middle region of CYP3 7 corresponding to a region with amino acids KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG
- Top Product
- Discover our top product CYP3A7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP3A7 Blocking Peptide, catalog no. 33R-4501, is also available for use as a blocking control in assays to test for specificity of this CYP3A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))
- Autre désignation
- CYP3A7 (CYP3A7 Produits)
- Synonymes
- anticorps CP37, anticorps CYPIIIA7, anticorps P450-HFLA, anticorps cytochrome P450, family 3, subfamily A, polypeptide 7, anticorps cytochrome P450 family 3 subfamily A member 7, anticorps CYP3A7
- Sujet
- CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-