CYP2D6 anticorps (Middle Region)
-
- Antigène Voir toutes CYP2D6 Anticorps
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP2D6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP2 D6 antibody was raised against the middle region of CYP2 6
- Purification
- Affinity purified
- Immunogène
- CYP2 D6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids EAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV
- Top Product
- Discover our top product CYP2D6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP2D6 Blocking Peptide, catalog no. 33R-2258, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))
- Autre désignation
- CYP2D6 (CYP2D6 Produits)
- Synonymes
- anticorps CPD6, anticorps CYP2D, anticorps CYP2D7AP, anticorps CYP2D7BP, anticorps CYP2D7P2, anticorps CYP2D8P2, anticorps CYP2DL1, anticorps CYPIID6, anticorps P450-DB1, anticorps P450C2D, anticorps P450DB1, anticorps CYP2D42, anticorps MGC64445, anticorps cyp2d2, anticorps cyp2d6-a, anticorps CYP2D6, anticorps cytochrome P450 family 2 subfamily D member 6, anticorps cytochrome P450, family 2, subfamily D, polypeptide 6, anticorps cytochrome 2D6, anticorps cytochrome P450 family 2 subfamily D member 6 S homeolog, anticorps cytochrome P450 2D6, anticorps cytochrome P450 2D6-like, anticorps CYP2D6, anticorps cyp2d6-b, anticorps cyp2d6.S, anticorps cyp2d6, anticorps LOC100988273
- Sujet
- CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.
- Poids moléculaire
- 56 kDa (MW of target protein)
-