CYP2A7 anticorps (N-Term)
-
- Antigène Voir toutes CYP2A7 Anticorps
- CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP2A7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP2 A7 antibody was raised against the N terminal of CYP2 7
- Purification
- Affinity purified
- Immunogène
- CYP2 A7 antibody was raised using the N terminal of CYP2 7 corresponding to a region with amino acids MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN
- Top Product
- Discover our top product CYP2A7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP2A7 Blocking Peptide, catalog no. 33R-6180, is also available for use as a blocking control in assays to test for specificity of this CYP2A7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP2A7 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 7 (CYP2A7))
- Autre désignation
- CYP2A7 (CYP2A7 Produits)
- Synonymes
- anticorps CPA7, anticorps CPAD, anticorps CYP2A, anticorps CYPIIA7, anticorps P450-IIA4, anticorps cytochrome P450 family 2 subfamily A member 7, anticorps CYP2A7
- Sujet
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum, its substrate has not yet been determined. This gene, which produces two transcript variants, is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
- Poids moléculaire
- 56 kDa (MW of target protein)
-