C12orf53 anticorps (Middle Region)

N° du produit ABIN636113

Détail du produit anti-C12orf53 anticorps

Antigène: C12orf53 (Chromosome 12 Open Reading Frame 53 (C12orf53))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C12orf53 est non-conjugé

Application: Western Blotting (WB)

Specificité: C12 ORF53 antibody was raised against the middle region of C12 rf53

Purification: Affinity purified

Immunogène: C12 ORF53 antibody was raised using the middle region of C12 rf53 corresponding to a region with amino acids VWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C12ORF53 Blocking Peptide, catalog no. 33R-9910, is also available for use as a blocking control in assays to test for specificity of this C12ORF53 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C12orf53

Antigène: C12orf53 (Chromosome 12 Open Reading Frame 53 (C12orf53))

Autre désignation: C12ORF53 (C12orf53 Produits)

Synonymes: anticorps C12orf53, anticorps PANP, anticorps leda-1, anticorps PILR alpha associated neural protein, anticorps PIANP

Sujet: The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 30 kDa (MW of target protein)