CGRP anticorps

N° du produit ABIN6654110

Détail du produit anti-CGRP anticorps

Antigène: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Reactivité: Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CGRP est non-conjugé

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP were used as the immunogen for the Calcitonin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Calcitonin antibody should be determined by the researcher.\. Immunohistochemistry (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Calcitonin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CGRP

Antigène: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Autre désignation: Calcitonin / CALCA / CGRP (CALCA Produits)

Synonymes: anticorps CALC1, anticorps CGRP, anticorps CGRP-I, anticorps CGRP1, anticorps CT, anticorps KC, anticorps CALC, anticorps CALCA, anticorps CALC3, anticorps ci-ct, anticorps calca, anticorps CA, anticorps CGRP-1, anticorps Calc, anticorps Calc1, anticorps Cgrp, anticorps Ct, anticorps Ctn, anticorps calcitonin, anticorps CAL6, anticorps Cal1, anticorps RATCAL6, anticorps CGRPI, anticorps calc, anticorps cgrp, anticorps zgc:92886, anticorps calcitonin related polypeptide alpha, anticorps calcitonin related polypeptide beta, anticorps calcitonin-related polypeptide alpha, anticorps calcitonin, anticorps calcitonin/calcitonin-related polypeptide, alpha, anticorps calcitonin-related polypeptide beta, anticorps calcitonin gene-related peptide 2, anticorps CALCA, anticorps CALCB, anticorps ci-ct, anticorps calca, anticorps Calca, anticorps LOC100008771

Sujet: Calcitonin, also known as CALCA, is a peptide hormone synthesized by the parafollicular cells of the thyroid. It is mapped to 11p15.2. Calcitonin belongs to the calcitonin-like protein family. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: P70160

Pathways: Hormone Activity, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Skeletal Muscle Fiber Development, Feeding Behaviour