PRND anticorps

N° du produit ABIN6719483

Détail du produit anti-PRND anticorps

Antigène: PRND (Prion Protein 2 (Dublet) (PRND))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRND est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: ATQAANQGEF QKPDNKLHQQ VLWRLVQELC SLKH

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Doppel detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human Doppel (ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH).

Isotype: IgG

Information d'application

Indications d'application:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL

Commentaires:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PRND

Antigène: PRND (Prion Protein 2 (Dublet) (PRND))

Autre désignation: PRND (PRND Produits)

Synonymes: anticorps PRND, anticorps DOPPEL, anticorps DPL, anticorps PrPLP, anticorps dJ1068H6.4, anticorps dpl, anticorps AI450264, anticorps Dpl, anticorps doppel, anticorps prion like protein doppel, anticorps PRND, anticorps Prnd

Sujet:

Synonyms: Prion-like protein doppel, PrPLP, Prion protein 2, PRND, DPL, UNQ1830/PRO3443

Background: Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.

ID gène: 23627

Pathways: Transition Metal Ion Homeostasis