KCNJ1 anticorps (C-Term, Intracellular)

N° du produit ABIN7043467

Détail du produit anti-KCNJ1 anticorps

Antigène: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Épitope: AA 342-391, C-Term, Intracellular

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNJ1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Immunocytochemistry (ICC), Immunoprecipitation (IP)

Attributs du produit: Anti-KCNJ1 (Kir1.1) Antibody (ABIN7043467, ABIN7044897 and ABIN7044898)) is a highly specific antibody directed against an epitope of the rat potassium channel ROM-K. The antibody can be used in western blot, immunohistochemistry, immunocytochemistry, and immunoprecipitation applications. It has been designed to recognize ROMK1 from rat, mouse, and human samples.

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogène:

Immunogen: GST fusion protein

Immunogen Sequence: GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: 25 μL, 50 μL or 0.2 mL double distilled water (DDW), depending on the sample size.

Concentration: 0.8 mg/mL

Buffer: Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1 % BSA, 0.05 % Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: RT,4 °C,-20 °C

Stockage commentaire:

Storage before reconstitution: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Storage after reconstitution: The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Détails sur KCNJ1

Antigène: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Autre désignation: KCNJ1 (Kir1.1) (KCNJ1 Produits)

Synonymes: anticorps KIR1.1, anticorps ROMK, anticorps ROMK1, anticorps kir1.1, anticorps romk1, anticorps Kcnj, anticorps Kir1.1, anticorps Romk2, anticorps kcnj1, anticorps wu:fl37c05, anticorps zgc:63534, anticorps potassium voltage-gated channel subfamily J member 1, anticorps potassium voltage-gated channel subfamily J member 1 L homeolog, anticorps potassium inwardly-rectifying channel, subfamily J, member 1, anticorps potassium inwardly-rectifying channel, subfamily J, member 1a, tandem duplicate 1, anticorps KCNJ1, anticorps kcnj1.L, anticorps kcnj1, anticorps Kcnj1, anticorps kcnj1a.1

Sujet: Alternative names: KCNJ1 (Kir1.1), ROMK1, ATP-sensitive inward rectifier potassium channel 1

ID gène: 24521

NCBI Accession: NM_000220

UniProt: P35560