anti-Rat (Rattus) SCP2 anticorps pour Immunofluorescence

Recommended SCP2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Sterol Carrier Protein 2 (SCP2) Anticorps
  • NLTP
  • NSL-TP
  • SCP-2
  • SCP-CHI
  • SCP-X
  • SCPX
  • AA409774
  • AA409893
  • C76618
  • C79031
  • ns-LTP
  • NSLIPTR
  • SCPx
  • MGC77634
  • zgc:77634
  • SCP2
  • MGC108409
  • ATSCP2
  • MBD2.8
  • MBD2_8
  • STEROL CARRIER PROTEIN 2
  • PLTP
  • sterol carrier protein 2
  • sterol carrier protein 2, liver
  • sterol carrier protein 2a
  • sterol carrier protein 2 L homeolog
  • phospholipid transfer protein homolog1
  • uncharacterized LOC101116445
  • SCP2
  • Scp2
  • scp2a
  • scp2.L
  • scp2
  • CC1G_13192
  • plt1
  • LOC101116445
Reactivité
Humain, Souris, Rat (Rattus)
136
34
29
5
4
3
3
3
2
2
1
1
1
1
Hôte
Lapin
103
19
15
Clonalité
Polyclonal
Conjugué
Cet anticorp SCP2 est non-conjugé
9
9
9
5
5
5
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
97
65
55
26
13
5
5
3
3
3
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4352277
Produit non disponible pour cette région.

General

Antigène Sterol Carrier Protein 2 (SCP2) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(136), (34), (29), (5), (4), (3), (3), (3), (2), (2), (1), (1), (1), (1)
Hôte Lapin
(103), (19), (15)
Clonalité
Polyclonal
Conjugué Cet anticorp SCP2 est non-conjugé
(9), (9), (9), (5), (5), (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(97), (65), (55), (26), (13), (5), (5), (3), (3), (3)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-SCP2 anticorps

Détail du antigène SCP2 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:GKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKH
Isotype IgG

Détail du antigène SCP2

Détail du produit anti-SCP2 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation SCP2 (SCP2 Antibody Extrait)
Sujet Gene Symbol: SYCP2
ID gène 10388
Pathways C21-Steroid Hormone Metabolic Process, Monocarboxylic Acid Catabolic Process

Information d'application

Détail du produit anti-SCP2 anticorps Détail du antigène SCP2 Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-SCP2 anticorps Détail du antigène SCP2 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-SCP2 anticorps Détail du antigène SCP2 Information d'application Stockage Haut de la page
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Sterol Carrier Protein 2 (SCP2) antibody (ABIN4352277) Immunohistochemistry-Paraffin: SCP2 Antibody [NBP1-85958] - Staining of human liver s...
Western Blotting (WB) image for anti-Sterol Carrier Protein 2 (SCP2) antibody (ABIN4352277) Western Blot: SCP2 Antibody [NBP1-85958] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-Sterol Carrier Protein 2 (SCP2) antibody (ABIN4352277) Immunocytochemistry/Immunofluorescence: SCP2 Antibody [NBP1-85958] - Staining of huma...
Western Blotting (WB) image for anti-Sterol Carrier Protein 2 (SCP2) antibody (ABIN4352277) Western Blot: SCP2 Antibody [NBP1-85958] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...