anti-Humain ZFP14 anticorps pour Immunohistochemistry

Recommended ZFP14 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Zinc Finger Protein 14 Homolog (ZFP14) Anticorps
  • ZNF531
  • 4732429I09Rik
  • Krox-9
  • Zfp-14
  • mKIAA1559
  • Zfp968
  • ZFP14 zinc finger protein
  • zinc finger protein 14
  • ZFP14
  • ZNF14
  • Zfp14
Reactivité
Humain
36
4
4
3
2
1
1
1
Hôte
Lapin
34
2
Clonalité
Polyclonal
Conjugué
Cet anticorp ZFP14 est non-conjugé
3
3
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
34
17
2
1
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4366824
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
-9.939373 ABIN4366996 ICC IF IHC IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Zinc Finger Protein 14 Homolog (ZFP14) Anticorps
Reactivité Humain
(36), (4), (4), (3), (2), (1), (1), (1)
Hôte Lapin
(34), (2)
Clonalité
Polyclonal
Conjugué Cet anticorp ZFP14 est non-conjugé
(3), (3), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(34), (17), (2), (1), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-ZFP14 anticorps

Détail du antigène ZFP14 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:AQRDLYRDVMWENYSNFISLAGPSISKPDVITLLDEERKEPGMVVREGTRRYCPDLESRYRTNTLSPEKDIYEIYSFQWDIMERIKSYSLQGSIFRNDWECKSKIEGEKEQQEGYFGQVKITSE
Isotype IgG
Plasmids, Primers & others

Détail du antigène ZFP14

Détail du produit anti-ZFP14 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation ZFP14 (ZFP14 Antibody Extrait)
Sujet Gene Symbol: ZFP14
ID gène 57677
Pathways Cellular Response to Molecule of Bacterial Origin

Information d'application

Détail du produit anti-ZFP14 anticorps Détail du antigène ZFP14 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-ZFP14 anticorps Détail du antigène ZFP14 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-ZFP14 anticorps Détail du antigène ZFP14 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Zinc Finger Protein 14 Homolog (ZFP14) antibody (ABIN4366824) Immunohistochemistry-Paraffin: ZFP14 Antibody - Staining of human pancreas shows str...
Immunofluorescence (IF) image for anti-Zinc Finger Protein 14 Homolog (ZFP14) antibody (ABIN4366824) Immunocytochemistry/Immunofluorescence: ZFP14 Antibody - Immunofluorescent staining ...