anti-Souris AIRE anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended AIRE Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Autoimmune Regulator (AIRE) Anticorps
  • AIRE1
  • APECED
  • APS1
  • APSI
  • PGA1
  • autoimmune regulator
  • autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermal dystrophy)
  • AaeL_AAEL013794
  • CpipJ_CPIJ001208
  • CpipJ_CPIJ001209
  • AIRE
  • Aire
Reactivité
Humain, Souris, Rat (Rattus)
147
70
29
11
9
8
5
4
4
2
1
Hôte
Lapin
96
57
18
1
Clonalité
Polyclonal
Conjugué
Cet anticorp AIRE est non-conjugé
8
6
5
5
5
5
2
2
2
2
2
2
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
146
85
39
34
18
18
12
6
5
5
2
1
1
1
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4282478
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN2615294 IHC (p) WB Rabbit IgG N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN2879521 IF IHC IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1714476 IF (p) IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2961768 IF IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Autoimmune Regulator (AIRE) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(147), (70), (29), (11), (9), (8), (5), (4), (4), (2), (1)
Hôte Lapin
(96), (57), (18), (1)
Clonalité
Polyclonal
Conjugué Cet anticorp AIRE est non-conjugé
(8), (6), (5), (5), (5), (5), (2), (2), (2), (2), (2), (2), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(146), (85), (39), (34), (18), (18), (12), (6), (5), (5), (2), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-AIRE anticorps

Détail du antigène AIRE Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:PEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQ
Isotype IgG

Détail du antigène AIRE

Détail du produit anti-AIRE anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation Autoimmune Regulator/AIRE (AIRE Antibody Extrait)
Sujet Gene Symbol: AIRE
ID gène 326
Pathways Chromatin Binding

Information d'application

Détail du produit anti-AIRE anticorps Détail du antigène AIRE Stockage Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-AIRE anticorps Détail du antigène AIRE Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-AIRE anticorps Détail du antigène AIRE Information d'application Stockage Haut de la page
Supplier Images
Western Blotting (WB) image for anti-Autoimmune Regulator (AIRE) antibody (ABIN4282478) Western Blot: Autoimmune Regulator/AIRE Antibody [NBP1-89046] - Lane 1: NIH-3T3 cell ...
Immunohistochemistry (IHC) image for anti-Autoimmune Regulator (AIRE) antibody (ABIN4282478) Immunohistochemistry: Autoimmune Regulator/AIRE Antibody [NBP1-89046] - Staining of h...
Western Blotting (WB) image for anti-Autoimmune Regulator (AIRE) antibody (ABIN4282478) Western Blot: Autoimmune Regulator/AIRE Antibody [NBP1-89046] - Lane 1: Marker [kDa] ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Autoimmune Regulator (AIRE) antibody (ABIN4282478) Immunohistochemistry-Paraffin: Autoimmune Regulator/AIRE Antibody [NBP1-89046] - Stai...
Immunofluorescence (IF) image for anti-Autoimmune Regulator (AIRE) antibody (ABIN4282478) Immunocytochemistry/Immunofluorescence: Autoimmune Regulator/AIRE Antibody [NBP1-8904...