anti-Humain CDK3 anticorps pour Immunocytochemistry

Recommended CDK3 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Cyclin-Dependent Kinase 3 (CDK3) Anticorps
  • AI852479
  • B230379H01Rik
  • cyclin dependent kinase 3
  • cyclin-dependent kinase 3
  • cyclin-dependent kinase-like 3
  • CDK3
  • cgd3_1510
  • Chro.30182
  • Cdkl3
Reactivité
Humain
78
30
20
3
3
2
Hôte
Lapin
74
4
Clonalité
Polyclonal
Conjugué
Cet anticorp CDK3 est non-conjugé
4
4
3
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
58
27
13
13
12
6
3
3
2
2
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4297051
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN5566391 FACS ICC IF IHC PE Rabbit AA 1-305 Connectez-vous pour afficher Polyclonal 0
1 ABIN5566389 FACS ICC IF IHC FITC Rabbit AA 1-305 Connectez-vous pour afficher Polyclonal 0
1 ABIN5566387 FACS ICC IF IHC APC Rabbit AA 1-305 Connectez-vous pour afficher Polyclonal 0

General

Antigène Cyclin-Dependent Kinase 3 (CDK3) Anticorps
Reactivité Humain
(78), (30), (20), (3), (3), (2)
Hôte Lapin
(74), (4)
Clonalité
Polyclonal
Conjugué Cet anticorp CDK3 est non-conjugé
(4), (4), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(58), (27), (13), (13), (12), (6), (3), (3), (2), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-CDK3 anticorps

Détail du antigène CDK3 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:PSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Isotype IgG
Plasmids, Primers & others

Détail du antigène CDK3

Détail du produit anti-CDK3 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation Cdk3 (CDK3 Antibody Extrait)
Sujet Gene Symbol: CDK3
ID gène 1018
Pathways Cycle Cellulaire

Information d'application

Détail du produit anti-CDK3 anticorps Détail du antigène CDK3 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-CDK3 anticorps Détail du antigène CDK3 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-CDK3 anticorps Détail du antigène CDK3 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Cyclin-Dependent Kinase 3 (CDK3) antibody (ABIN4297051) Immunocytochemistry/Immunofluorescence: Cdk3 Antibody [NBP1-86496] - Immunofluorescen...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cyclin-Dependent Kinase 3 (CDK3) antibody (ABIN4297051) Immunohistochemistry-Paraffin: Cdk3 Antibody [NBP1-86496] - Staining of human kidney ...
Immunofluorescence (IF) image for anti-Cyclin-Dependent Kinase 3 (CDK3) antibody (ABIN4297051) Immunocytochemistry/Immunofluorescence: Cdk3 Antibody - Immunofluorescent staining o...