anti-Humain Cyclin B3 anticorps pour Immunohistochemistry

Recommended Cyclin B3 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Cyclin B3 (CCNB3) Anticorps
  • CG5814
  • Cyc B3
  • Dmel\\CG5814
  • anon-WO0118547.414
  • cycB3
  • l(3)L6540
  • ccnb3-a
  • zgc:153369
  • MGC154490
  • NV16541
  • CCNB3
  • CYCB3
  • RGD1564367
  • Cyclin B3
  • cyclin B3 S homeolog
  • cyclin B3
  • cyclin B3 L homeolog
  • G2/mitotic-specific cyclin-B3
  • CycB3
  • ccnb3.S
  • ccnb3
  • ccnb3.L
  • LOC5572162
  • LOC100122822
  • CCNB3
  • LOC100394742
  • Ccnb3
Reactivité
Humain
77
62
49
21
1
Hôte
Lapin
176
2
Clonalité
Polyclonal
Conjugué
Cet anticorp Cyclin B3 est non-conjugé
16
16
16
16
16
16
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
147
122
30
1
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4288907
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN2889635 ELISA IF IHC Rabbit IgG AA 1221-1270 Connectez-vous pour afficher Polyclonal 0

General

Antigène Cyclin B3 (CCNB3) Anticorps
Reactivité Humain
(77), (62), (49), (21), (1)
Hôte Lapin
(176), (2)
Clonalité
Polyclonal
Conjugué Cet anticorp Cyclin B3 est non-conjugé
(16), (16), (16), (16), (16), (16)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(147), (122), (30), (1), (1), (1), (1)
Pubmed 2 références disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-Cyclin B3 anticorps

Détail du antigène Cyclin B3 Information d'application Stockage References for anti-Cyclin B3 antibody (ABIN4288907) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:KMCASQRKQSCQEESLAVQDVNMEEDSFFMESMSFKKKPKTEESIPTHKLSSLKKKCTIYGKICHFRKPPVLQTTICGAMSSIKKPTTEKETLFQELSVLQEKHTTEHEMS
Isotype IgG
Plasmids, Primers & others

Détail du antigène Cyclin B3

Détail du produit anti-Cyclin B3 anticorps Information d'application Stockage References for anti-Cyclin B3 antibody (ABIN4288907) Images Haut de la page
Antigène
Autre désignation CCNB3 (CCNB3 Antibody Extrait)
Sujet Gene Symbol: CCNB3
ID gène 85417
Pathways Cycle Cellulaire, Chromatin Binding

Information d'application

Détail du produit anti-Cyclin B3 anticorps Détail du antigène Cyclin B3 Stockage References for anti-Cyclin B3 antibody (ABIN4288907) Images Haut de la page
Indications d'application Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-Cyclin B3 anticorps Détail du antigène Cyclin B3 Information d'application References for anti-Cyclin B3 antibody (ABIN4288907) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-Cyclin B3 antibody (ABIN4288907)

Détail du produit anti-Cyclin B3 anticorps Détail du antigène Cyclin B3 Information d'application Stockage Images Haut de la page
Produit citée dans:

Peters, Kumar, Polikepahad, Lin, Sarabia, Liang, Wang, Lazar, Doddapaneni, Chao, Muzny, Wheeler, Okcu, Plon, Hicks, López-Terrada, Parsons, Roy: "BCOR-CCNB3 fusions are frequent in undifferentiated sarcomas of male children." dans: Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, Vol. 28, Issue 4, pp. 575-86, 2015 (Échantillon (espèces): Human). Détails: Immunohistochemistry

Pierron, Tirode, Lucchesi, Reynaud, Ballet, Cohen-Gogo, Perrin, Coindre, Delattre: "A new subtype of bone sarcoma defined by BCOR-CCNB3 gene fusion." dans: Nature genetics, Vol. 44, Issue 4, pp. 461-6, 2012

Images

Détail du produit anti-Cyclin B3 anticorps Détail du antigène Cyclin B3 Information d'application Stockage References for anti-Cyclin B3 antibody (ABIN4288907) Haut de la page
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cyclin B3 (CCNB3) antibody (ABIN4288907) Immunohistochemistry-Paraffin: CCNB3 Antibody [NBP1-89475] - Staining of human small ...
Immunofluorescence (IF) image for anti-Cyclin B3 (CCNB3) antibody (ABIN4288907) Immunocytochemistry/Immunofluorescence: CCNB3 Antibody [NBP1-89475] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cyclin B3 (CCNB3) antibody (ABIN4288907) Immunohistochemistry-Paraffin: CCNB3 Antibody [NBP1-89475] - Staining of human testis...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cyclin B3 (CCNB3) antibody (ABIN4288907) Immunohistochemistry-Paraffin: CCNB3 Antibody - Staining of human liver shows no pos...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cyclin B3 (CCNB3) antibody (ABIN4288907) Immunohistochemistry-Paraffin: CCNB3 Antibody - Staining of human testis shows stron...