anti-Humain AP2B1 anticorps pour Immunocytochemistry

Recommended AP2B1 Antibody (fourni par: Connectez-vous pour afficher )

Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1) Anticorps
  • ADTB2
  • AP105B
  • AP2-BETA
  • CLAPB1
  • 1300012O03Rik
  • AI788979
  • fa16e07
  • wu:fa16c06
  • wu:fa16e07
  • wu:fc18c08
  • zgc:55659
  • adaptor related protein complex 2 beta 1 subunit
  • adaptor-related protein complex 2, beta 1 subunit
  • adaptor related protein complex 2 beta 1 subunit L homeolog
  • AP2B1
  • Ap2b1
  • ap2b1
  • ap2b1.L
Cet anticorp AP2B1 est non-conjugé
Immunocytochemistry (ICC), Immunofluorescence (IF)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN5075286
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN5950995 ICC IF IHC IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal 0


Antigène Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1) Anticorps
Reactivité Humain
(71), (34), (25), (8), (6), (6), (6), (6), (5), (3), (3), (3), (3), (1)
Hôte Lapin
(68), (3)
Conjugué Cet anticorp AP2B1 est non-conjugé
(3), (3), (3), (2), (2), (2), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(66), (34), (19), (4), (4), (3), (2), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-AP2B1 anticorps

Détail du antigène AP2B1 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKA
Isotype IgG
Plasmids, Primers & others

Détail du antigène AP2B1

Détail du produit anti-AP2B1 anticorps Information d'application Stockage Images Haut de la page
Autre désignation Beta 2 Adaptin (AP2B1 Antibody Extrait)
Sujet Gene Symbol: AP2B1
ID gène 163
Pathways EGFR Signaling Pathway, Neurotrophin Signaling Pathway, EGFR Downregulation

Information d'application

Détail du produit anti-AP2B1 anticorps Détail du antigène AP2B1 Stockage Images Haut de la page
Indications d'application Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-AP2B1 anticorps Détail du antigène AP2B1 Information d'application Images Haut de la page
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit anti-AP2B1 anticorps Détail du antigène AP2B1 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1) antibody (ABIN5075286) Immunocytochemistry/Immunofluorescence: Beta 2 Adaptin Antibody - Staining of human ...
Immunofluorescence (fixed cells) (IF/ICC) image for anti-Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1) antibody (ABIN5075286) Immunocytochemistry/Immunofluorescence: Beta 2 Adaptin Antibody - Staining of human ...
Western Blotting (WB) image for anti-Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1) antibody (ABIN5075286) Western Blot: Beta 2 Adaptin Antibody - Analysis in human cell line RT-4 and human c...