anti-Humain ERBB2IP anticorps pour Immunofluorescence

Recommended ERBB2IP Antibody (fourni par: Connectez-vous pour afficher )

Erbb2 Interacting Protein (ERBB2IP) Anticorps
  • LAP2
  • 1700028E05Rik
  • Erbin
  • mKIAA1225
  • Erbb2i
  • Erbb2ip
  • RGD1562952
  • erbb2ip
  • zgc:152984
  • erbb2 interacting protein
  • apurinic/apyrimidinic endodeoxyribonuclease 1
  • Erbb2 interacting protein
  • erbin
  • Erbin
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN4309327
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
-0.50904703 ABIN5076578 ICC IF WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0


Antigène Erbb2 Interacting Protein (ERBB2IP) Anticorps
Reactivité Humain
(37), (5), (2), (1), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(27), (7), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(32), (23), (6), (2), (2), (2), (1), (1), (1), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-ERBB2IP anticorps

Détail du antigène ERBB2IP Information d'application Stockage References for anti-ERBB2IP antibody (ABIN4309327) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: WHSKQNPQIDHASFPPQLLPRSESTENQSYAKHSANMNFSNHNNVRANTA YHLHQRLGPARHGEMWAISPNDRLIPAVTRSTIQR
Isotype IgG
Plasmids, Primers & others

Détail du antigène ERBB2IP

Détail du produit anti-ERBB2IP anticorps Information d'application Stockage References for anti-ERBB2IP antibody (ABIN4309327) Images Haut de la page
Autre désignation Erbin (ERBB2IP Antibody Extrait)
Sujet Gene Symbol: ERBB2IP
ID gène 55914
Pathways EGFR Signaling Pathway, Asymmetric Protein Localization

Information d'application

Détail du produit anti-ERBB2IP anticorps Détail du antigène ERBB2IP Stockage References for anti-ERBB2IP antibody (ABIN4309327) Images Haut de la page
Indications d'application Western Blot 1:500 - 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-ERBB2IP anticorps Détail du antigène ERBB2IP Information d'application References for anti-ERBB2IP antibody (ABIN4309327) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-ERBB2IP antibody (ABIN4309327)

Détail du produit anti-ERBB2IP anticorps Détail du antigène ERBB2IP Information d'application Stockage Images Haut de la page
Produit citée dans:

Li, Zhou, Li, Wu, Liu, Zhao, Jia, Sun: "Inhibition of Neddylation Modification Sensitizes Pancreatic Cancer Cells to Gemcitabine." dans: Neoplasia (New York, N.Y.), Vol. 19, Issue 6, pp. 509-518, 2017 Méthode utilisée: Immunohistochemistry (IHC) (Échantillon (espèces): Human).


Détail du produit anti-ERBB2IP anticorps Détail du antigène ERBB2IP Information d'application Stockage References for anti-ERBB2IP antibody (ABIN4309327) Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Erbb2 Interacting Protein (ERBB2IP) antibody (ABIN4309327) Immunocytochemistry/Immunofluorescence: Erbin Antibody [NBP2-13968] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Erbb2 Interacting Protein (ERBB2IP) antibody (ABIN4309327) Immunohistochemistry-Paraffin: Erbin Antibody [NBP2-13968] - Staining of human breast...
Western Blotting (WB) image for anti-Erbb2 Interacting Protein (ERBB2IP) antibody (ABIN4309327) Western Blot: Erbin Antibody [NBP2-13968] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Immunofluorescence (IF) image for anti-Erbb2 Interacting Protein (ERBB2IP) antibody (ABIN4309327) Immunocytochemistry/Immunofluorescence: Erbin Antibody - Immunofluorescent staining ...