anti-Humain FGF1 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended FGF1 Antibody (fourni par: Connectez-vous pour afficher )

Fibroblast Growth Factor 1 (Acidic) (FGF1) Anticorps
  • AFGF
  • ECGF
  • ECGF-beta
  • FGF-1
  • FGF-alpha
  • FGFA
  • GLIO703
  • HBGF-1
  • HBGF1
  • Fgf1
  • FGF1
  • aFGF
  • ecgf
  • fgfa
  • ecgfa
  • ecgfb
  • fgf-1
  • hbgf1
  • glio703
  • ecgf-beta
  • fgf-alpha
  • Dffrx
  • Fam
  • Fgf-1
  • Fgfa
  • zgc:136885
  • LOC100221393
  • fibroblast growth factor 1
  • fibroblast growth factor 1 L homeolog
  • fibroblast growth factor 1b
  • FGF1
  • fgf1.L
  • fgf1
  • Fgf1
  • fgf1b
  • LOC100221393
Cet anticorp FGF1 est non-conjugé
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN4311439
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN390361 IF IHC (p) WB Rabbit Ig Fraction AA 5-30, N-Term Connectez-vous pour afficher Polyclonal 1
1 ABIN4886581 ELISA IHC (p) WB Rabbit IgG AA 16-155 Connectez-vous pour afficher Polyclonal
1 ABIN5610974 EIA IHC (p) WB Rabbit Ig Fraction N-Term Connectez-vous pour afficher Polyclonal
1 ABIN3044308 ELISA IHC (p) WB Rabbit IgG AA 16-155 Connectez-vous pour afficher Polyclonal
1 ABIN626047 IF IHC (p) IP ELISA WB Mouse IgG1, kappa AA 46-155 Connectez-vous pour afficher 2E12
1 ABIN626048 IF IHC (p) ELISA WB Mouse IgG1, kappa AA 46-155 Connectez-vous pour afficher 1F9
1 ABIN726590 IF (p) IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN1498254 IHC (p) Neut ELISA WB Rabbit Connectez-vous pour afficher Polyclonal
1 ABIN2450557 IP IHC (p) Neut ELISA WB Rabbit IgG AA 16-155 Connectez-vous pour afficher Polyclonal
1 ABIN781861 EIA IF IHC (p) WB Mouse IgG1 Connectez-vous pour afficher 1F9
1 ABIN781862 EIA IF IHC (p) IP WB Mouse IgG1 Connectez-vous pour afficher 2-00E-012
1 ABIN726599 IHC (p) HRP Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN2892580 IHC (p) Rabbit His56 Connectez-vous pour afficher Polyclonal
1 ABIN116006 EIA Func IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal
1 ABIN726592 IHC (p) Biotin Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN2601884 ELISA IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal
1 ABIN116005 EIA Func IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal
1 ABIN1841218 IF IHC (p) WB Rabbit AA 5-30 Connectez-vous pour afficher Polyclonal
1 ABIN515608 IF IHC (p) IP ELISA WB Mouse IgG1 kappa AA 46-155, partial Connectez-vous pour afficher 2E12 1
1 ABIN515609 IF IHC (p) ELISA WB Mouse IgG1 kappa AA 46-155, partial Connectez-vous pour afficher 1F9


Antigène Fibroblast Growth Factor 1 (Acidic) (FGF1) Anticorps
Reactivité Humain
(157), (80), (54), (19), (9), (6), (6), (5), (4), (3), (3), (2), (1), (1), (1), (1)
Hôte Lapin
(171), (52)
Conjugué Cet anticorp FGF1 est non-conjugé
(19), (14), (9), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(145), (121), (49), (29), (28), (24), (13), (12), (10), (9), (6), (5), (4), (2), (2), (2), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-FGF1 anticorps

Détail du antigène FGF1 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:GEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHTDTK
Isotype IgG

Détail du antigène FGF1

Détail du produit anti-FGF1 anticorps Information d'application Stockage Images Haut de la page
Autre désignation FGF Acidic/FGF1 (FGF1 Antibody Extrait)
Sujet Gene Symbol: FGF1
ID gène 2246
Pathways Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway

Information d'application

Détail du produit anti-FGF1 anticorps Détail du antigène FGF1 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-FGF1 anticorps Détail du antigène FGF1 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit anti-FGF1 anticorps Détail du antigène FGF1 Information d'application Stockage Haut de la page
Supplier Images
Immunofluorescence (IF) image for anti-Fibroblast Growth Factor 1 (Acidic) (FGF1) antibody (ABIN4311439) Immunocytochemistry/Immunofluorescence: FGF1 Antibody [NBP1-89213] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Fibroblast Growth Factor 1 (Acidic) (FGF1) antibody (ABIN4311439) Immunohistochemistry-Paraffin: FGF1 Antibody [NBP1-89213] - Staining of human kidney ...