anti-Humain B4GALT3 anticorps pour Immunocytochemistry

Recommended B4GALT3 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) Anticorps
  • beta4Gal-T3
  • 9530061M23Rik
  • AA104562
  • AW125175
  • ESTM26
  • ESTM6
  • R74981
  • b4Gal-T3
  • beta-1,4-galactosyltransferase 3
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 S homeolog
  • UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 3
  • B4GALT3
  • b4galt3.S
  • B4galt3
Reactivité
Humain, Souris
58
24
23
8
5
5
5
4
3
3
2
1
1
Hôte
Lapin
51
7
Clonalité
Polyclonal
Conjugué
Cet anticorp B4GALT3 est non-conjugé
4
4
4
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
50
32
28
7
7
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4282655
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN6258613 ELISA ICC IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) Anticorps
Reactivité Humain, Souris
(58), (24), (23), (8), (5), (5), (5), (4), (3), (3), (2), (1), (1)
Hôte Lapin
(51), (7)
Clonalité
Polyclonal
Conjugué Cet anticorp B4GALT3 est non-conjugé
(4), (4), (4)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(50), (32), (28), (7), (7), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-B4GALT3 anticorps

Détail du antigène B4GALT3 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:YFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGS
Isotype IgG
Plasmids, Primers & others

Détail du antigène B4GALT3

Détail du produit anti-B4GALT3 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation B4GALT3 (B4GALT3 Antibody Extrait)
Sujet Gene Symbol: B4GALT3
ID gène 8703
Pathways Glycosaminoglycan Metabolic Process

Information d'application

Détail du produit anti-B4GALT3 anticorps Détail du antigène B4GALT3 Stockage Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-B4GALT3 anticorps Détail du antigène B4GALT3 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-B4GALT3 anticorps Détail du antigène B4GALT3 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) antibody (ABIN4282655) Western Blot: B4GALT3 Antibody [NBP1-88653] - Lane 1: NIH-3T3 cell lysate (Mouse embr...
Western Blotting (WB) image for anti-UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) antibody (ABIN4282655) Western Blot: B4GALT3 Antibody [NBP1-88653] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) antibody (ABIN4282655) Immunohistochemistry-Paraffin: B4GALT3 Antibody [NBP1-88653] - Staining of human rect...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) antibody (ABIN4282655) Immunohistochemistry-Paraffin: B4GALT3 Antibody [NBP1-88653] - Staining of human stom...
Immunofluorescence (IF) image for anti-UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) antibody (ABIN4282655) Immunocytochemistry/Immunofluorescence: B4GALT3 Antibody [NBP1-88653] - Staining of h...