anti-Souris B4GALT3 anticorps pour Western Blotting

Recommended B4GALT3 Antibody (fourni par: Connectez-vous pour afficher )

UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) Anticorps
  • beta4Gal-T3
  • 9530061M23Rik
  • AA104562
  • AW125175
  • ESTM26
  • ESTM6
  • R74981
  • b4Gal-T3
  • beta-1,4-galactosyltransferase 3
  • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 S homeolog
  • UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 3
  • B4GALT3
  • b4galt3.S
  • B4galt3
Middle Region
Humain, Souris, Rat (Rattus)
Cet anticorp B4GALT3 est non-conjugé
Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN635885
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
13.802353 ABIN1850910 IHC ELISA WB Rabbit Internal Region Connectez-vous pour afficher Polyclonal 0
10.802353 ABIN6258613 ELISA ICC IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
7.802353 ABIN2782250 WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 0
7.802353 ABIN2705558 IP IHC WB Rabbit Center Connectez-vous pour afficher Polyclonal 0
7.802353 ABIN1534693 IHC ELISA WB Rabbit IgG AA 271-320 Connectez-vous pour afficher Polyclonal 2
7 ABIN2890162 ELISA IHC IHC (p) WB Rabbit IgG AA 271-320 Connectez-vous pour afficher Polyclonal 0
7 ABIN317820 IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal 0
7 ABIN1574952 IHC ELISA WB Rabbit Connectez-vous pour afficher Polyclonal 0
4.802353 ABIN2782251 WB Rabbit Middle Region Connectez-vous pour afficher Polyclonal 1
4.802353 ABIN2782252 WB Rabbit C-Term Connectez-vous pour afficher Polyclonal 0
4.802353 ABIN5997281 IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4 ABIN575029 WB Rabbit AA 71-120 Connectez-vous pour afficher Polyclonal 0
4 ABIN469130 WB Rabbit AA 288-337 Connectez-vous pour afficher Polyclonal 0
1 ABIN2589652 IHC IHC (p) IP WB Rabbit Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN6292663 IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN6104905 ELISA IHC WB Rabbit IgG Internal Region Connectez-vous pour afficher Polyclonal 0
1 ABIN2992333 IHC IP WB Rabbit Connectez-vous pour afficher Polyclonal 0


Antigène UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) Anticorps
Épitope Middle Region
(10), (4), (4), (4), (2), (2), (2), (2), (2), (1), (1), (1)
Reactivité Humain, Souris, Rat (Rattus)
(57), (22), (22), (8), (5), (5), (5), (4), (3), (3), (2), (1), (1)
Hôte Lapin
(50), (7)
Conjugué Cet anticorp B4GALT3 est non-conjugé
(4), (4), (4)
Application Western Blotting (WB)
(49), (32), (28), (7), (7), (2), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-B4GALT3 anticorps

Détail du antigène B4GALT3 Information d'application Stockage Images
Specificité B4 GALT3 antibody was raised against the middle region of B4 ALT3
Purification Affinity purified
Immunogène B4 GALT3 antibody was raised using the middle region of B4 ALT3 corresponding to a region with amino acids MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN
Plasmids, Primers & others

Détail du antigène B4GALT3

Détail du produit anti-B4GALT3 anticorps Information d'application Stockage Images Haut de la page
Autre désignation B4GALT3 (B4GALT3 Antibody Extrait)
Sujet This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose, all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor.
Poids moléculaire 44 kDa (MW of target protein)
Pathways Glycosaminoglycan Metabolic Process

Information d'application

Détail du produit anti-B4GALT3 anticorps Détail du antigène B4GALT3 Stockage Images Haut de la page
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

B4GALT3 Blocking Peptide, catalog no. 33R-6588, is also available for use as a blocking control in assays to test for specificity of this B4GALT3 antibody

Restrictions For Research Use only


Détail du produit anti-B4GALT3 anticorps Détail du antigène B4GALT3 Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALT3 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Détail du produit anti-B4GALT3 anticorps Détail du antigène B4GALT3 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-UDP-Gal:betaGlcNAc beta 1,4- Galactosyltransferase, Polypeptide 3 (B4GALT3) (Middle Region) antibody (ABIN635885) B4GALT3 antibody used at 1 ug/ml to detect target protein.