anti-Humain Osteomodulin anticorps pour Immunofluorescence

Recommended Osteomodulin Antibody (fourni par: Connectez-vous pour afficher )

Osteomodulin (OMD) Anticorps
  • si:ch211-103f16.5
  • OMD
  • OSAD
  • SLRR2C
  • osteomodulin
  • omd
  • OMD
  • Omd
Immunocytochemistry (ICC), Immunofluorescence (IF)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher


N° du produit ABIN5946332
Produit non disponible pour cette région.


Antigène Osteomodulin (OMD) Anticorps
Reactivité Humain
(42), (17), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Hôte Lapin
(40), (8)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(38), (14), (8), (7), (4), (3), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Protein A purified
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: PGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIP
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Autre désignation Osteoadherin/OSAD/OMD (OMD Antibody Extrait)
Sujet Gene Symbol: OMD
ID gène 4958
Pathways Glycosaminoglycan Metabolic Process

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Immunocytochemistry/Immunofluorescence 1 - 4 μg/mLRecommended conditions: Fixation/Permeabilization: PFA/Triton X-100

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS,  pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (fixed cells) (IF/ICC) image for anti-Osteomodulin (OMD) antibody (ABIN5946332) Immunocytochemistry/Immunofluorescence: Osteoadherin/OSAD/OMD Antibody - Staining of...