anti-Humain Versican anticorps pour Immunocytochemistry

Recommended Versican Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Versican (Vcan) Anticorps
  • br146
  • cspg2
  • cspg2a
  • sb:cb63
  • versican
  • CSPG2
  • Cspg2
  • wgn
  • ervr
  • pg-m
  • wgn1
  • Xversican
  • dcan
  • cspg2b
  • fb99b07
  • wu:fb99b07
  • ERVR
  • GHAP
  • PG-M
  • WGN
  • WGN1
  • 5430420N07Rik
  • 9430051N09
  • DPEAAE
  • NG2
  • PG-M(V0)
  • PG-M(V1)
  • hdf
  • versican a
  • versican
  • versican b
  • vcana
  • VCAN
  • Vcan
  • vcan
  • vcanb
Reactivité
Humain
111
103
80
7
3
3
1
1
1
1
1
1
Hôte
Lapin
103
46
2
1
Clonalité
Polyclonal
Conjugué
Inconjugué
7
6
6
4
4
3
3
3
3
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
123
60
43
22
22
20
17
13
10
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4365244
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN1860937 ICC IHC WB Rabbit IgG AA 2958-3209 Connectez-vous pour afficher Polyclonal 0
1 ABIN2485735 ICC IF WB Atto 390 Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485736 ICC IF WB Atto 488 Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485737 ICC IF WB Atto 565 Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485739 ICC IF WB Atto 633 Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485741 ICC IF WB Atto 680 Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485740 ICC IF WB Atto 655 Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485744 ICC IF WB APC Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485743 ICC IF WB Alkaline Phosphatase (AP) Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485746 ICC IF WB FITC Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485749 ICC IF WB PerCP Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485748 ICC IF WB PE-Atto 594 Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485750 ICC IF WB PE Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485751 ICC IF WB Streptavidin Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485738 ICC IF WB Atto 594 Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485742 ICC IF WB Atto 700 Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485745 ICC IF WB Biotin Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN2485747 ICC IF WB HRP Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN1686648 ICC IF WB Mouse IgG1 AA 362-585 Connectez-vous pour afficher S351-23 0
1 ABIN292878 ICC IHC ELISA WB Goat IgG AA 1344-1554 Connectez-vous pour afficher Polyclonal 0

General

Antigène Versican (Vcan) Anticorps
Reactivité Humain
(111), (103), (80), (7), (3), (3), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(103), (46), (2), (1)
Clonalité
Polyclonal
Conjugué Inconjugué
(7), (6), (6), (4), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(123), (60), (43), (22), (22), (20), (17), (13), (10), (1), (1), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Référence Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDTQDTVSLTVDGVVFHYRAATSRYTLNFEAA
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Référence Images Haut de la page
Antigène
Autre désignation Versican (Vcan Antibody Extrait)
Sujet Gene Symbol: VCAN
ID gène 1462
UniProt P13611
Pathways Glycosaminoglycan Metabolic Process

Information d'application

Détail du produit Détail du antigène Stockage Référence Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500Immunohistochemistry retrieval recommended: HIER pH 6
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Référence Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Référence

Détail du produit Détail du antigène Information d'application Stockage Images Haut de la page
Produit citée dans:

Van Bockstal, Lambein, Van Gele, De Vlieghere, Limame, Braems, Van den Broecke, Cocquyt, Denys, Bracke, Libbrecht, De Wever: "Differential regulation of extracellular matrix protein expression in carcinoma-associated fibroblasts by TGF-β1 regulates cancer cell spreading but not adhesion." dans: Oncoscience, Vol. 1, Issue 10, pp. 634-48, 2015 (Échantillon (espèces): Human). Détails: Immunohistochemistry

Images

Détail du produit Détail du antigène Information d'application Stockage Référence Haut de la page
Images (Fournisseur)
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human tonsil shows no...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human uterine cervix ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human stomach shows m...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human cerebral cortex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining of human cerebral cortex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Versican (Vcan) antibody (ABIN4365244) Immunohistochemistry-Paraffin: Versican Antibody - Staining in human cerebral cortex...