anti-Humain Phosphatidylinositol Glycan Anchor Biosynthesis, Class S anticorps pour Immunohistochemistry

Recommended Phosphatidylinositol Glycan Anchor Biosynthesis, Class S Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Phosphatidylinositol Glycan Anchor Biosynthesis, Class S (PIGS) Anticorps
  • BC058979
  • Gm393
  • Gm689
  • phosphatidylinositol glycan anchor biosynthesis class S
  • phosphatidylinositol glycan anchor biosynthesis, class S
  • PIGS
  • Pigs
Reactivité
Humain
33
7
2
2
2
2
2
2
1
1
1
1
1
1
1
Hôte
Lapin
30
4
Clonalité
Polyclonal
Conjugué
Inconjugué
3
3
3
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
30
25
2
1
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Images

N° du produit ABIN4345571
Produit non disponible pour cette région.

General

Antigène Phosphatidylinositol Glycan Anchor Biosynthesis, Class S (PIGS) Anticorps
Reactivité Humain
(33), (7), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(30), (4)
Clonalité
Polyclonal
Conjugué Inconjugué
(3), (3), (3), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(30), (25), (2), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:SVLPVRVEVDMVRVMEVFLAQLRLLFGIAQPQLPPKCLLSGPTSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQ
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation PIGS (PIGS Antibody Extrait)
Sujet Gene Symbol: PIGS
ID gène 94005
Pathways Inositol Metabolic Process

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phosphatidylinositol Glycan Anchor Biosynthesis, Class S (PIGS) antibody (ABIN4345571) Immunohistochemistry-Paraffin: PIGS Antibody [NBP1-86050] - Staining of human spleen ...
Western Blotting (WB) image for anti-Phosphatidylinositol Glycan Anchor Biosynthesis, Class S (PIGS) antibody (ABIN4345571) Western Blot: PIGS Antibody [NBP1-86050] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Phosphatidylinositol Glycan Anchor Biosynthesis, Class S (PIGS) antibody (ABIN4345571) Immunohistochemistry-Paraffin: PIGS Antibody - Staining of human spleen shows strong...