anti-Humain PLCD4 anticorps pour Immunocytochemistry

Recommended PLCD4 Antibody (fourni par: Connectez-vous pour afficher )

Phospholipase C, delta 4 (PLCD4) Anticorps
  • PLCD4
  • PLCL3
  • si:dkeyp-84a8.7
  • 4921507K24Rik
  • phospholipase C eta 1
  • phospholipase C delta 4
  • phospholipase C, delta 4a
  • phospholipase C, delta 4
  • phospholipase C delta 4 L homeolog
  • PLCH1
  • PLCD4
  • plcd4a
  • plcd4
  • Plcd4
  • plcd4.L
Cet anticorp PLCD4 est non-conjugé
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN4346138
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN5014114 ICC IHC WB Rabbit IgG AA 1-250 Connectez-vous pour afficher Polyclonal 0


Antigène Phospholipase C, delta 4 (PLCD4) Anticorps
Reactivité Humain
(23), (7), (6)
Hôte Lapin
(22), (4)
Conjugué Cet anticorp PLCD4 est non-conjugé
(1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(15), (13), (12), (4), (3), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-PLCD4 anticorps

Détail du antigène PLCD4 Information d'application Stockage Images
Purification Immunogen affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: GFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLH
Plasmids, Primers & others

Détail du antigène PLCD4

Détail du produit anti-PLCD4 anticorps Information d'application Stockage Images Haut de la page
Autre désignation PLCD4 (PLCD4 Antibody Extrait)
Sujet Gene Symbol: PLCD4
ID gène 84812
UniProt Q9BRC7
Pathways Inositol Metabolic Process

Information d'application

Détail du produit anti-PLCD4 anticorps Détail du antigène PLCD4 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-PLCD4 anticorps Détail du antigène PLCD4 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit anti-PLCD4 anticorps Détail du antigène PLCD4 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Phospholipase C, delta 4 (PLCD4) antibody (ABIN4346138) Immunocytochemistry/Immunofluorescence: PLCD4 Antibody [NBP2-38393] - Immunofluoresce...
Immunohistochemistry (IHC) image for anti-Phospholipase C, delta 4 (PLCD4) antibody (ABIN4346138) Immunohistochemistry: PLCD4 Antibody [NBP2-38393] - Staining of human testis shows mo...