anti-Humain PLCD4 anticorps pour Immunohistochemistry

Recommended PLCD4 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Phospholipase C, delta 4 (PLCD4) Anticorps
  • PLCD4
  • PLCL3
  • si:dkeyp-84a8.7
  • 4921507K24Rik
  • phospholipase C eta 1
  • phospholipase C delta 4
  • phospholipase C, delta 4a
  • phospholipase C, delta 4
  • phospholipase C delta 4 L homeolog
  • PLCH1
  • PLCD4
  • plcd4a
  • plcd4
  • Plcd4
  • plcd4.L
Reactivité
Humain
23
7
6
Hôte
Lapin
22
4
Clonalité
Polyclonal
Conjugué
Cet anticorp PLCD4 est non-conjugé
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
15
13
12
4
3
2
2
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4346137
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
8.459862 ABIN4346138 ICC IF IHC IHC (p) Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN5014114 ICC IHC WB Rabbit IgG AA 1-250 Connectez-vous pour afficher Polyclonal 0
1 ABIN6058717 ELISA IHC Rabbit IgG AA 1-762 Connectez-vous pour afficher Polyclonal 0
1 ABIN6095566 ELISA IF/ICC IHC Rabbit IgG AA 1-290 Connectez-vous pour afficher Polyclonal 0
1 ABIN5999710 IF/ICC IHC IP WB Rabbit AA 1-250 Connectez-vous pour afficher Polyclonal 0
1 ABIN5698963 ELISA IHC Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1090190 IHC ELISA Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2920048 ELISA IHC Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2149231 IHC ELISA Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN5881779 ELISA IHC Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Phospholipase C, delta 4 (PLCD4) Anticorps
Reactivité Humain
(23), (7), (6)
Hôte Lapin
(22), (4)
Clonalité
Polyclonal
Conjugué Cet anticorp PLCD4 est non-conjugé
(1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(15), (13), (12), (4), (3), (2), (2), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-PLCD4 anticorps

Détail du antigène PLCD4 Information d'application Stockage Images
Purification Immunogen affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELL
Plasmids, Primers & others

Détail du antigène PLCD4

Détail du produit anti-PLCD4 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation PLCD4 (PLCD4 Antibody Extrait)
Sujet Gene Symbol: PLCD4
ID gène 84812
UniProt Q9BRC7
Pathways Inositol Metabolic Process

Information d'application

Détail du produit anti-PLCD4 anticorps Détail du antigène PLCD4 Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-PLCD4 anticorps Détail du antigène PLCD4 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-PLCD4 anticorps Détail du antigène PLCD4 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Phospholipase C, delta 4 (PLCD4) antibody (ABIN4346137) Immunohistochemistry: PLCD4 Antibody [NBP2-38392] - Staining of human skeletal muscle...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phospholipase C, delta 4 (PLCD4) antibody (ABIN4346137) Immunohistochemistry-Paraffin: PLCD4 Antibody - Staining of human heart muscle shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Phospholipase C, delta 4 (PLCD4) antibody (ABIN4346137) Immunohistochemistry-Paraffin: PLCD4 Antibody - Staining in human skeletal muscle an...