anti-Humain MED13 anticorps pour Immunocytochemistry

Recommended MED13 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Mediator Complex Subunit 13 (MED13) Anticorps
  • THRAP1
  • ARC250
  • DRIP250
  • HSPC221
  • TRAP240
  • 1110067M05Rik
  • D030023K18
  • Thrap1
  • Trap240
  • mediator complex subunit 13
  • MED13
  • Med13
Reactivité
Humain
15
5
1
1
Hôte
Lapin
15
Clonalité
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF)
11
8
7
3
2
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN5078030
Produit non disponible pour cette région.

General

Antigène Mediator Complex Subunit 13 (MED13) Anticorps
Reactivité Humain
(15), (5), (1), (1)
Hôte Lapin
(15)
Clonalité
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(11), (8), (7), (3), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-MED13 anticorps

Détail du antigène MED13 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SASVQVASATYTTENLDLAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTGSPVHSPGSHYPHGGDAGKGQSTDRLLSTEPH
Isotype IgG

Détail du antigène MED13

Détail du produit anti-MED13 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation MED13 (MED13 Antibody Extrait)
Sujet Gene Symbol: MED13
ID gène 9969
Pathways Intracellular Steroid Hormone Receptor Signaling Pathway, Nuclear Hormone Receptor Binding, Regulation of Lipid Metabolism by PPARalpha

Information d'application

Détail du produit anti-MED13 anticorps Détail du antigène MED13 Stockage Images Haut de la page
Indications d'application Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-MED13 anticorps Détail du antigène MED13 Information d'application Images Haut de la page
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-MED13 anticorps Détail du antigène MED13 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Mediator Complex Subunit 13 (MED13) antibody (ABIN5078030) Immunocytochemistry/Immunofluorescence: MED13 Antibody - Staining of human cell line...