anti-Humain Zinc Finger Protein 366 anticorps pour Immunofluorescence

Recommended Zinc Finger Protein 366 Antibody (fourni par: Connectez-vous pour afficher )

Zinc Finger Protein 366 (ZNF366) Anticorps
  • zinc finger protein 366
  • ZNF366
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN4304373
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
-2.0860052 ABIN4304374 ICC IF IHC IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal 0


Antigène Zinc Finger Protein 366 (ZNF366) Anticorps
Reactivité Humain
(39), (2), (2), (2), (1)
Hôte Lapin
(36), (3)
Conjugué Inconjugué
(3), (3), (3), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(32), (25), (3), (3), (2), (1), (1), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:DLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRGPFSQFRYEPPPGDLDGFPGVFEGAGSRKRKSMPTKMPYNH
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Autre désignation DC-SCRIPT/ZNF366 (ZNF366 Antibody Extrait)
Sujet Gene Symbol: ZNF366
ID gène 167465
Pathways Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Zinc Finger Protein 366 (ZNF366) antibody (ABIN4304373) Immunocytochemistry/Immunofluorescence: DC-SCRIPT/ZNF366 Antibody [NBP1-81921] - Stai...
Immunohistochemistry (IHC) image for anti-Zinc Finger Protein 366 (ZNF366) antibody (ABIN4304373) Immunohistochemistry: DC-SCRIPT/ZNF366 Antibody [NBP1-81921] - Staining of human gall...