anti-Souris Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 anticorps pour Western Blotting

Recommended Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 (PSMD8) Anticorps
  • HIP6
  • HYPF
  • Nin1p
  • Rpn12
  • S14
  • p31
  • hip6
  • hypf
  • nin1p
  • rpn12
  • psmd8b
  • 6720456J22Rik
  • AA407360
  • AL033291
  • AL033322
  • AL033323
  • C76433
  • psmd8
  • psmd8a
  • fa93g07
  • fb17c09
  • fb49a10
  • zgc:86762
  • wu:fa93g07
  • wu:fb17c09
  • wu:fb49a10
  • PSMD8
  • proteasome 26S subunit, non-ATPase 8
  • proteasome 26S subunit, non-ATPase 8 S homeolog
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
  • proteasome 26S subunit, non-ATPase 8 L homeolog
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 pseudogene
  • PSMD8
  • psmd8.S
  • Psmd8
  • psmd8.L
  • psmd8
  • LOC468490
Reactivité
Humain, Souris, Rat (Rattus)
44
31
26
2
2
2
2
2
1
1
1
1
Hôte
Lapin
35
8
2
Clonalité
Polyclonal
Conjugué
Inconjugué
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
27
15
13
7
7
3
3
2
1
1
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Images

N° du produit ABIN630918
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
12.342568 ABIN1742386 ICC IP WB Rabbit AA 4-232 Connectez-vous pour afficher Polyclonal 2
10.842568 ABIN2970177 IF/ICC IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
10.842568 ABIN6570808 IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
10.842568 ABIN2564777 IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
10.842568 ABIN6005502 IF/ICC IHC WB Rabbit IgG full length Connectez-vous pour afficher Polyclonal 0
10.842568 ABIN2966954 IC IF IHC WB Rabbit Connectez-vous pour afficher Polyclonal 0
7.7166495 ABIN4348308 ICC IF IHC IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.842569 ABIN2783285 WB Rabbit C-Term Connectez-vous pour afficher Polyclonal 0
4.842569 ABIN2459182 ELISA WB Rabbit Connectez-vous pour afficher Polyclonal 0
4.842569 ABIN2468067 WB Chicken AA 1-257 Connectez-vous pour afficher Polyclonal 0
4.842569 ABIN6718504 IF IHC WB Rabbit Connectez-vous pour afficher Polyclonal 0
4 ABIN6738429 WB Rabbit IgG C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN1420180 IHC (p) WB HRP Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN6759994 IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1402309 IHC (p) WB Biotin Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1386252 IF (p) IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 (PSMD8) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(44), (31), (26), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Hôte Lapin
(35), (8), (2)
Clonalité
Polyclonal
Conjugué Inconjugué
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(27), (15), (13), (7), (7), (3), (3), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Purification Affinity purified
Immunogène PSMD8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation PSMD8 (PSMD8 Antibody Extrait)
Sujet The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. PSMD8 is a non-ATPase subunit of the 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.
Poids moléculaire 27 kDa (MW of target protein)
Pathways Mitotic G1-G1/S Phases, DNA Replication, Proton Transport, Synthesis of DNA

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

PSMD8 Blocking Peptide, catalog no. 33R-2234, is also available for use as a blocking control in assays to test for specificity of this PSMD8 antibody

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD8 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 (PSMD8) antibody (ABIN630918) PSMD8 antibody used at 1 ug/ml to detect target protein.