anti-Chien ATP2A2 anticorps pour Western Blotting

Recommended ATP2A2 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) Anticorps
  • atp2b
  • ca-p60a
  • dar
  • serca2
  • ATP2A2
  • ATP2B
  • DAR
  • DD
  • SERCA2
  • SERCA2A
  • ATP2
  • Serca2
  • SercaII
  • 9530097L16Rik
  • D5Wsu150e
  • SERCA2B
  • mKIAA4195
  • atp2a2
  • zgc:55380
  • ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 S homeolog
  • ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2
  • ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
  • ATPase, Ca++ transporting, cardiac muscle, slow twitch 2a
  • atp2a1.S
  • ATP2A2
  • Atp2a2
  • atp2a2a
Épitope
C-Term
11
10
10
7
4
4
3
2
2
2
2
2
1
1
1
Reactivité
Humain, Souris, Rat (Rattus), Chien, Mouche des fruits (Drosophila melanogaster)
68
41
39
12
7
7
6
6
5
4
3
3
2
2
2
2
1
1
1
1
1
1
1
Hôte
Lapin
64
6
3
Clonalité
Polyclonal
Conjugué
Cet anticorp ATP2A2 est non-conjugé
3
3
3
2
2
2
Application
Western Blotting (WB)
70
35
24
12
7
6
4
3
2
2
1
1
1
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN634681
$ 473.93
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
10.802582 ABIN2782136 IHC WB Rabbit C-Term Connectez-vous pour afficher Polyclonal 1
4.802582 ABIN2559878 ELISA WB Goat IgG Internal Region Connectez-vous pour afficher Polyclonal 0
4 ABIN2617318 IHC IHC (p) WB Rabbit IgG AA 794-843 Connectez-vous pour afficher Polyclonal 0
1 ABIN2738411 IHC IHC (p) WB Rabbit IgG AA 1-32 Connectez-vous pour afficher Polyclonal 0

General

Antigène ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) Anticorps
Épitope C-Term
(11), (10), (10), (7), (4), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1)
Reactivité Humain, Souris, Rat (Rattus), Chien, Mouche des fruits (Drosophila melanogaster)
(68), (41), (39), (12), (7), (7), (6), (6), (5), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(64), (6), (3)
Clonalité
Polyclonal
Conjugué Cet anticorp ATP2A2 est non-conjugé
(3), (3), (3), (2), (2), (2)
Application Western Blotting (WB)
(70), (35), (24), (12), (7), (6), (4), (3), (2), (2), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-ATP2A2 anticorps

Détail du antigène ATP2A2 Information d'application Stockage Images
Specificité ATP2 A2 antibody was raised against the C terminal of ATP2 2
Purification Affinity purified
Immunogène ATP2 A2 antibody was raised using the C terminal of ATP2 2 corresponding to a region with amino acids VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV
Plasmids, Primers & others

Détail du antigène ATP2A2

Détail du produit anti-ATP2A2 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation ATP2A2 (ATP2A2 Antibody Extrait)
Sujet ATP2A2 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.
Poids moléculaire 115 kDa (MW of target protein)
Pathways Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process

Information d'application

Détail du produit anti-ATP2A2 anticorps Détail du antigène ATP2A2 Stockage Images Haut de la page
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

ATP2A2 Blocking Peptide, catalog no. 33R-9709, is also available for use as a blocking control in assays to test for specificity of this ATP2A2 antibody

Restrictions For Research Use only

Stockage

Détail du produit anti-ATP2A2 anticorps Détail du antigène ATP2A2 Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Détail du produit anti-ATP2A2 anticorps Détail du antigène ATP2A2 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (C-Term) antibody (ABIN634681) ATP2A2 antibody used at 1 ug/ml to detect target protein.