anti-Humain Guanine Nucleotide Binding Protein (G Protein), beta 5 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended Guanine Nucleotide Binding Protein (G Protein), beta 5 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Guanine Nucleotide Binding Protein (G Protein), beta 5 (GNB5) Anticorps
  • GB5
  • GBS
  • Gbeta5
  • flr
  • G protein subunit beta 5
  • guanine nucleotide binding protein (G protein), beta 5
  • GNB5
  • Gnb5
Reactivité
Humain
59
31
19
2
2
2
2
1
1
1
1
1
Hôte
Lapin
54
5
Clonalité
Polyclonal
Conjugué
Inconjugué
5
4
3
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
52
34
18
5
2
1
1
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4315239
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
12.35866 ABIN315562 IHC (p) IHC WB Rabbit Connectez-vous pour afficher Polyclonal 0
12.35866 ABIN305790 IHC IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal 0
12.35866 ABIN1714058 IF (p) IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1734847 IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN303322 IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal 0

General

Antigène Guanine Nucleotide Binding Protein (G Protein), beta 5 (GNB5) Anticorps
Reactivité Humain
(59), (31), (19), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Hôte Lapin
(54), (5)
Clonalité
Polyclonal
Conjugué Inconjugué
(5), (4), (3), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(52), (34), (18), (5), (2), (1), (1), (1), (1), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Référence Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:TFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCM
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Référence Images Haut de la page
Antigène
Autre désignation GNB5 (GNB5 Antibody Extrait)
Sujet Gene Symbol: GNB5
ID gène 10681
Pathways Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Thromboxane A2 Receptor Signaling

Information d'application

Détail du produit Détail du antigène Stockage Référence Images Haut de la page
Indications d'application Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Référence Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Référence

Détail du produit Détail du antigène Information d'application Stockage Images Haut de la page
Produit citée dans:

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." dans: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013

Images

Détail du produit Détail du antigène Information d'application Stockage Référence Haut de la page
Images (Fournisseur)
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Guanine Nucleotide Binding Protein (G Protein), beta 5 (GNB5) antibody (ABIN4315239) Immunohistochemistry-Paraffin: GNB5 Antibody [NBP1-83390] - Immunohistochemical stain...
Immunofluorescence (IF) image for anti-Guanine Nucleotide Binding Protein (G Protein), beta 5 (GNB5) antibody (ABIN4315239) Immunocytochemistry/Immunofluorescence: GNB5 Antibody [NBP1-83390] - Staining of huma...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Guanine Nucleotide Binding Protein (G Protein), beta 5 (GNB5) antibody (ABIN4315239) Immunohistochemistry-Paraffin: GNB5 Antibody - Staining of human hippocampus shows m...