anti-Humain Regulator of G-Protein Signaling 9 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended Regulator of G-Protein Signaling 9 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Regulator of G-Protein Signaling 9 (RGS) Anticorps
  • LOC100218209
  • RGS9-1
  • Rgs9-2
  • PERRS
  • RGS9L
  • regulator of G-protein signaling 9
  • regulator of G protein signaling 9
  • RGS9
  • Tsp_08067
  • Rgs9
Épitope
N-Term
12
11
7
4
3
3
2
2
1
1
Reactivité
Humain
45
18
14
4
4
3
2
2
2
1
Hôte
Lapin
46
3
Clonalité
Polyclonal
Conjugué
Inconjugué
2
2
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
47
26
24
6
2
2
2
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4350364
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
10.933373 ABIN5079321 IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN202538 IHC IHC (p) WB Rabbit IgG AA 230-279 Connectez-vous pour afficher Polyclonal 0
1 ABIN658157 IHC (p) WB Rabbit Ig Fraction AA 149-178, N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN5532989 IHC (p) WB Rabbit Ig Fraction AA 149-178, N-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN5586995 IHC (p) WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN1810281 IHC IHC (p) WB Rabbit AA 149-178 Connectez-vous pour afficher Polyclonal 0

General

Antigène Regulator of G-Protein Signaling 9 (RGS) Anticorps
Épitope N-Term
(12), (11), (7), (4), (3), (3), (2), (2), (1), (1)
Reactivité Humain
(45), (18), (14), (4), (4), (3), (2), (2), (2), (1)
Hôte Lapin
(46), (3)
Clonalité
Polyclonal
Conjugué Inconjugué
(2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(47), (26), (24), (6), (2), (2), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Purification Protein A purified
Immunogène Synthetic peptides corresponding to RGS9 (regulator of G-protein signalling 9) The peptide sequence was selected from the N terminal of RGS9. Peptide sequence MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ.

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation RGS9 (RGS Antibody Extrait)
Sujet Gene Symbol: RGS9
ID gène 8787
UniProt O75916
Pathways Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against RGS9 and was validated on Western Blot and immunohistochemistry-paraffin
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock -20 °C
Stockage commentaire Store at -20°C. Avoid freeze-thaw cycles.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Regulator of G-Protein Signaling 9 (RGS) (N-Term) antibody (ABIN4350364) Western Blot: RGS9 Antibody [NBP1-58919] - HepG2 cell lysate, Antibody Titration: 2.0...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Regulator of G-Protein Signaling 9 (RGS) (N-Term) antibody (ABIN4350364) Immunohistochemistry-Paraffin: RGS9 Antibody [NBP1-58919] - Human Liver Tissue, antib...