anti-Souris Regulator of G-Protein Signaling 9 anticorps pour Western Blotting

Recommended Regulator of G-Protein Signaling 9 Antibody (fourni par: Connectez-vous pour afficher )

Regulator of G-Protein Signaling 9 (RGS) Anticorps
  • LOC100218209
  • RGS9-1
  • Rgs9-2
  • RGS9L
  • regulator of G-protein signaling 9
  • regulator of G protein signaling 9
  • RGS9
  • Tsp_08067
  • Rgs9
Humain, Souris, Rat (Rattus), Chien
Immunohistochemistry (IHC), Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN630222
$ 437.50
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
7.7976923 ABIN2792222 IHC WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 1
7.7976923 ABIN5014264 ICC IHC WB Rabbit IgG AA 1-296 Connectez-vous pour afficher Polyclonal 0
7.7976923 ABIN6001486 IF/ICC IHC IP WB Rabbit AA 1-296 Connectez-vous pour afficher Polyclonal 0
7 ABIN202538 IHC IHC (p) WB Rabbit IgG AA 230-279 Connectez-vous pour afficher Polyclonal 0
4.7976923 ABIN6264728 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.7976923 ABIN3042642 WB Rabbit IgG AA 624-638, C-Term Connectez-vous pour afficher Polyclonal 0
4.7976923 ABIN4905002 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.7976923 ABIN2467889 WB Chicken AA 21-200 Connectez-vous pour afficher Polyclonal 0
4.7976923 ABIN5996202 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.7976923 ABIN3032456 WB Rabbit IgG C-Term Connectez-vous pour afficher Polyclonal 0
1 ABIN2627630 WB Rabbit IgG AA 624-638 Connectez-vous pour afficher Polyclonal 0
1 ABIN295409 ELISA WB Chicken IgY AA 21-200 Connectez-vous pour afficher Polyclonal 0
1 ABIN2463713 IHC ELISA WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN5699345 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1091466 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2923652 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN5885563 ELISA WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0


Antigène Regulator of G-Protein Signaling 9 (RGS) Anticorps
Épitope N-Term
(12), (11), (7), (4), (3), (3), (2), (2), (1), (1)
Reactivité Humain, Souris, Rat (Rattus), Chien
(45), (17), (13), (4), (3), (3), (2), (2), (2), (1)
Hôte Lapin
(46), (3)
Conjugué Inconjugué
(2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(47), (26), (24), (7), (2), (2), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité RGS9 antibody was raised against the N terminal of RGS9
Purification Purified
Immunogène RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Autre désignation RGS9 (RGS Antibody Extrait)
Sujet RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.
Poids moléculaire 49 kDa (MW of target protein)
Pathways Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

RGS9 Blocking Peptide, catalog no. 33R-6633, is also available for use as a blocking control in assays to test for specificity of this RGS9 antibody

Restrictions For Research Use only


Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS9 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Regulator of G-Protein Signaling 9 (RGS) (N-Term) antibody (ABIN630222) RGS9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Western Blotting (WB) image for anti-Regulator of G-Protein Signaling 9 (RGS) (N-Term) antibody (ABIN630222) RGS9 antibody used at 2 ug/ml to detect target protein.