anti-Rat (Rattus) Regulator of G-Protein Signaling 9 anticorps pour Immunohistochemistry

Recommended Regulator of G-Protein Signaling 9 Antibody (fourni par: Connectez-vous pour afficher )

Regulator of G-Protein Signaling 9 (RGS) Anticorps
  • LOC100218209
  • RGS9-1
  • Rgs9-2
  • RGS9L
  • regulator of G-protein signaling 9
  • regulator of G protein signaling 9
  • RGS9
  • Tsp_08067
  • Rgs9
Humain, Souris, Rat (Rattus), Chien
Immunohistochemistry (IHC), Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher


N° du produit ABIN630222
$ 437.50
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
9.900635 ABIN2792222 IHC WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 1
7 ABIN202538 IHC IHC (p) WB Rabbit IgG AA 230-279 Connectez-vous pour afficher Polyclonal 0
1 ABIN2463713 IHC ELISA WB Rabbit Connectez-vous pour afficher Polyclonal 0


Antigène Regulator of G-Protein Signaling 9 (RGS) Anticorps
Épitope N-Term
(12), (11), (7), (4), (3), (3), (2), (2), (1), (1)
Reactivité Humain, Souris, Rat (Rattus), Chien
(46), (17), (13), (4), (3), (3), (2), (2), (2), (1)
Hôte Lapin
(47), (3)
Conjugué Inconjugué
(2), (2), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Western Blotting (WB)
(48), (26), (24), (7), (2), (2), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité RGS9 antibody was raised against the N terminal of RGS9
Purification Purified
Immunogène RGS9 antibody was raised using the N terminal of RGS9 corresponding to a region with amino acids MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Autre désignation RGS9 (RGS Antibody Extrait)
Sujet RGS9 is a member of the RGS family of signaling proteins that suppress the activity of G proteins by promoting their deactivation.
Poids moléculaire 49 kDa (MW of target protein)
Pathways Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Phototransduction

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

RGS9 Blocking Peptide, catalog no. 33R-6633, is also available for use as a blocking control in assays to test for specificity of this RGS9 antibody

Restrictions For Research Use only


Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS9 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Regulator of G-Protein Signaling 9 (RGS) (N-Term) antibody (ABIN630222) RGS9 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Western Blotting (WB) image for anti-Regulator of G-Protein Signaling 9 (RGS) (N-Term) antibody (ABIN630222) RGS9 antibody used at 2 ug/ml to detect target protein.