anti-Humain rho Guanine Nucleotide Exchange Factor (GEF) 4 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended rho Guanine Nucleotide Exchange Factor (GEF) 4 Antibody (fourni par: Connectez-vous pour afficher )

rho Guanine Nucleotide Exchange Factor (GEF) 4 (ARHGEF4) Anticorps
  • ASEF
  • ASEF1
  • GEF4
  • STM6
  • 9330140K16Rik
  • Asef
  • ENSMUSG00000070955
  • Rho guanine nucleotide exchange factor 4
  • uncharacterized LOC100470646
  • rho guanine nucleotide exchange factor 4
  • Rho guanine nucleotide exchange factor (GEF) 4
  • arhg4
  • LOC100470646
  • LOC100544917
  • Arhgef4
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus


N° du produit ABIN4281554
Produit non disponible pour cette région.


Antigène rho Guanine Nucleotide Exchange Factor (GEF) 4 (ARHGEF4) Anticorps
Reactivité Humain
(52), (5), (2), (1), (1), (1), (1), (1)
Hôte Lapin
(22), (18), (12)
Conjugué Inconjugué
(7), (3), (3), (3), (3), (3)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(49), (34), (11), (2)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Autre désignation ARHGEF4 (ARHGEF4 Antibody Extrait)
Sujet Gene Symbol: ARHGEF4
ID gène 50649
Pathways Neurotrophin Signaling Pathway

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-rho Guanine Nucleotide Exchange Factor (GEF) 4 (ARHGEF4) antibody (ABIN4281554) Immunohistochemistry: ARHGEF4 Antibody [NBP1-88857] - Staining of human bone marrow s...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-rho Guanine Nucleotide Exchange Factor (GEF) 4 (ARHGEF4) antibody (ABIN4281554) Immunohistochemistry-Paraffin: ARHGEF4 Antibody - Staining of human cerebral cortex ...