anti-Humain ARHGEF6 anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended ARHGEF6 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
rho Guanine Nucleotide Exchange Factor (GEF) 6 (ARHGEF6) Anticorps
  • COOL2
  • Cool-2
  • MRX46
  • PIXA
  • alpha-PIX
  • alphaPIX
  • 1600028C08Rik
  • 1700038J06Rik
  • 4930592P22Rik
  • Rac/Cdc42 guanine nucleotide exchange factor 6
  • Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
  • ARHGEF6
  • Arhgef6
Reactivité
Humain
37
3
3
Hôte
Lapin
31
6
Clonalité
Polyclonal
Conjugué
Cet anticorp ARHGEF6 est non-conjugé
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
33
20
5
3
1
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4281559
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN5572985 IF IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène rho Guanine Nucleotide Exchange Factor (GEF) 6 (ARHGEF6) Anticorps
Reactivité Humain
(37), (3), (3)
Hôte Lapin
(31), (6)
Clonalité
Polyclonal
Conjugué Cet anticorp ARHGEF6 est non-conjugé
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(33), (20), (5), (3), (1), (1), (1), (1)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-ARHGEF6 anticorps

Détail du antigène ARHGEF6 Information d'application Stockage References for anti-ARHGEF6 antibody (ABIN4281559) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:VQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHS
Isotype IgG
Plasmids, Primers & others

Détail du antigène ARHGEF6

Détail du produit anti-ARHGEF6 anticorps Information d'application Stockage References for anti-ARHGEF6 antibody (ABIN4281559) Images Haut de la page
Antigène
Autre désignation ARHGEF6 (ARHGEF6 Antibody Extrait)
Sujet Gene Symbol: ARHGEF6
Poids moléculaire Theoretical MW: 87 kDa
ID gène 9459
UniProt Q15052
Pathways Neurotrophin Signaling Pathway

Information d'application

Détail du produit anti-ARHGEF6 anticorps Détail du antigène ARHGEF6 Stockage References for anti-ARHGEF6 antibody (ABIN4281559) Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry 1:50-1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation/permeabilization: PFA/Triton X-100. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-ARHGEF6 anticorps Détail du antigène ARHGEF6 Information d'application References for anti-ARHGEF6 antibody (ABIN4281559) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-ARHGEF6 antibody (ABIN4281559)

Détail du produit anti-ARHGEF6 anticorps Détail du antigène ARHGEF6 Information d'application Stockage Images Haut de la page
Produit citée dans:

Kortüm, Harms, Hennighausen, Rosenberger: "αPIX Is a Trafficking Regulator that Balances Recycling and Degradation of the Epidermal Growth Factor Receptor." dans: PLoS ONE, Vol. 10, Issue 7, pp. e0132737, 2015

Images

Détail du produit anti-ARHGEF6 anticorps Détail du antigène ARHGEF6 Information d'application Stockage References for anti-ARHGEF6 antibody (ABIN4281559) Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-rho Guanine Nucleotide Exchange Factor (GEF) 6 (ARHGEF6) antibody (ABIN4281559) Western Blot: ARHGEF6 Antibody [NBP1-89124] - Lane 1: Marker [kDa] 230, 110, 82, 49, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-rho Guanine Nucleotide Exchange Factor (GEF) 6 (ARHGEF6) antibody (ABIN4281559) Immunohistochemistry-Paraffin: ARHGEF6 Antibody [NBP1-89124] - Staining of human stom...
Immunofluorescence (IF) image for anti-rho Guanine Nucleotide Exchange Factor (GEF) 6 (ARHGEF6) antibody (ABIN4281559) Immunocytochemistry/Immunofluorescence: ARHGEF6 Antibody [NBP1-89124] - Staining of h...
Immunofluorescence (IF) image for anti-rho Guanine Nucleotide Exchange Factor (GEF) 6 (ARHGEF6) antibody (ABIN4281559) Immunocytochemistry/Immunofluorescence: ARHGEF6 Antibody - Immunofluorescent stainin...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-rho Guanine Nucleotide Exchange Factor (GEF) 6 (ARHGEF6) antibody (ABIN4281559) Immunohistochemistry-Paraffin: ARHGEF6 Antibody - Staining of human tonsil shows cyt...