anti-Poulet NR2F1 anticorps pour Western Blotting

Recommended NR2F1 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1) Anticorps
  • COUP-TFI
  • EAR-3
  • EAR3
  • ERBAL3
  • NR2F2
  • SVP44
  • TCFCOUP1
  • TFCOUP1
  • COUP-TF1
  • COUPTFA
  • Erbal3
  • Tcfcoup1
  • COUP(VI)
  • couptf6
  • fc10d05
  • nr2f1
  • svp44
  • wu:fc10d05
  • COUP-TF
  • ear3
  • ear-3
  • nr2f2
  • erbal3
  • tfcoup1
  • coup-tfi
  • tcfcoup1
  • nr2f1l
  • zgc:65854
  • zgc:77353
  • nuclear receptor subfamily 2 group F member 1
  • nuclear receptor subfamily 2, group F, member 1
  • nuclear receptor subfamily 2, group F, member 1a
  • nuclear receptor subfamily 2 group F member 1 L homeolog
  • nuclear receptor subfamily 2, group F, member 1b
  • NR2F1
  • Nr2f1
  • nr2f1a
  • nr2f1.L
  • nr2f1
  • nr2f1b
Épitope
C-Term
25
11
7
3
2
2
2
1
1
1
1
1
Reactivité
Poulet, Humain
62
27
18
13
8
8
4
4
3
3
3
3
3
1
1
1
Hôte
Lapin
55
7
Clonalité
Polyclonal
Conjugué
Cet anticorp NR2F1 est non-conjugé
2
2
2
2
2
2
Application
Western Blotting (WB)
60
24
5
5
5
4
3
1
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4889997
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN321358 WB Rabbit IgG AA 326-375 Connectez-vous pour afficher Polyclonal 0

General

Antigène Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1) Anticorps
Épitope C-Term
(25), (11), (7), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivité Poulet, Humain
(62), (27), (18), (13), (8), (8), (4), (4), (3), (3), (3), (3), (3), (1), (1), (1)
Hôte Lapin
(55), (7)
Clonalité
Polyclonal
Conjugué Cet anticorp NR2F1 est non-conjugé
(2), (2), (2), (2), (2), (2)
Application Western Blotting (WB)
(60), (24), (5), (5), (5), (4), (3), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-NR2F1 anticorps

Détail du antigène NR2F1 Information d'application Stockage Images
Purification Immunogen affinity purified
Immunogène Synthetic peptides corresponding to NR2F1(nuclear receptor subfamily 2, group F, member 1) The peptide sequence was selected from the C terminal of NR2F1. Peptide sequence VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP.
Plasmids, Primers & others

Détail du antigène NR2F1

Détail du produit anti-NR2F1 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation COUP-TF I/NR2F1 (NR2F1 Antibody Extrait)
Sujet Gene Symbol: NR2F1
ID gène 7025
UniProt P10589
Pathways Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway

Information d'application

Détail du produit anti-NR2F1 anticorps Détail du antigène NR2F1 Stockage Images Haut de la page
Indications d'application Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against NR2F1 and was validated on Western blot.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-NR2F1 anticorps Détail du antigène NR2F1 Information d'application Images Haut de la page
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock -20 °C
Stockage commentaire Store at -20°C. Avoid freeze-thaw cycles.

Images

Détail du produit anti-NR2F1 anticorps Détail du antigène NR2F1 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1) (C-Term) antibody (ABIN4889997) Western Blot: COUP-TF I/NR2F1 Antibody [NBP1-52831] - Titration: 0.2-1 ug/ml, Positiv...
Western Blotting (WB) image for anti-Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1) (C-Term) antibody (ABIN4889997) Western Blot: COUP-TF I/NR2F1 Antibody [NBP1-52831] - Titration: 2 ug/ml Positive Con...