anti-Humain BRISC and BRCA1 A Complex Member 1 anticorps pour Immunocytochemistry

Recommended BRISC and BRCA1 A Complex Member 1 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
BRISC and BRCA1 A Complex Member 1 (BABAM1) Anticorps
  • merit40
  • nba1
  • zgc:100909
  • c19orf62
  • C19orf62
  • MERIT40
  • NBA1
  • C7H19orf62
  • 5430437P03Rik
  • Merit40
  • BRISC and BRCA1 A complex member 1
  • BRISC and BRCA1 A complex member 1 L homeolog
  • babam1
  • BABAM1
  • babam1.L
  • Babam1
Reactivité
Humain
73
5
4
2
2
2
1
1
Hôte
Lapin
38
32
2
1
Clonalité
Polyclonal
Conjugué
Inconjugué
4
4
4
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
2
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
64
36
32
21
19
7
3
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN5078051
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
-6.842285 ABIN4232093 ICC IF WB Mouse IgG2a Connectez-vous pour afficher 1251 0
-6.842285 ABIN4232094 ICC IF WB Mouse IgG2b Connectez-vous pour afficher 2810 0
-12.842285 ABIN5946199 ICC IF Janelia Fluor® 549 Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5946200 ICC IF Janelia Fluor® 646 Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5946201 ICC IF Janelia Fluor® 549 Mouse IgG2b Connectez-vous pour afficher 2810 0
-12.842285 ABIN5946202 ICC IF Janelia Fluor® 646 Mouse IgG2b Connectez-vous pour afficher 2810 0
-12.842285 ABIN5626527 ICC IF WB DyLight 650 Mouse IgG2b Connectez-vous pour afficher 2810 0
-12.842285 ABIN5626504 ICC IF WB Alexa Fluor 405 Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5626508 ICC IF WB Biotin Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5626520 ICC IF WB Alexa Fluor 647 Mouse IgG2b Connectez-vous pour afficher 2810 0
-12.842285 ABIN5626516 ICC IF FITC Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5626526 ICC IF WB DyLight 550 Mouse IgG2b Connectez-vous pour afficher 2810 0
-12.842285 ABIN5626512 ICC IF WB DyLight 550 Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5626530 ICC IF FITC Mouse IgG2b Connectez-vous pour afficher 2810 0
-12.842285 ABIN5626510 ICC IF WB DyLight 405 Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5626514 ICC IF WB DyLight 680 Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5626513 ICC IF WB DyLight 650 Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5626515 ICC IF WB DyLight 755 Mouse IgG2a Connectez-vous pour afficher 1251 0
-12.842285 ABIN5626521 ICC IF WB Alexa Fluor 700 Mouse IgG2b Connectez-vous pour afficher 2810 0
-12.842285 ABIN5626511 ICC IF WB DyLight 488 Mouse IgG2a Connectez-vous pour afficher 1251 0

General

Antigène BRISC and BRCA1 A Complex Member 1 (BABAM1) Anticorps
Reactivité Humain
(73), (5), (4), (2), (2), (2), (1), (1)
Hôte Lapin
(38), (32), (2), (1)
Clonalité
Polyclonal
Conjugué Inconjugué
(4), (4), (4), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Western Blotting (WB)
(64), (36), (32), (21), (19), (7), (3), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit

Détail du antigène Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICL
Isotype IgG

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation MERIT40/HSPC142 (BABAM1 Antibody Extrait)
Sujet Gene Symbol: BABAM1
ID gène 29086
Pathways Positive Regulation of Response to DNA Damage Stimulus

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-BRISC and BRCA1 A Complex Member 1 (BABAM1) antibody (ABIN5078051) Western Blot: MERIT40/HSPC142 Antibody - Western blot analysis in human cell line RT...
Immunofluorescence (IF) image for anti-BRISC and BRCA1 A Complex Member 1 (BABAM1) antibody (ABIN5078051) Immunocytochemistry/Immunofluorescence: MERIT40/HSPC142 Antibody - Staining of human...