Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag)

Détails pour le produit réf. ABIN3077209
Nom de la protéine
  • SDR38C1
  • AA409688
  • ENSMUSG00000071345
  • Gm10328
  • CG12117
  • Dmel\\CG12117
  • SR
  • sptr
  • xspr
  • DDBDRAFT_0188686
  • DDBDRAFT_0191275
  • DDB_0188686
  • DDB_0191275
  • zgc:194446
  • sepiapterin reductase
  • Sepiapterin reductase
  • sepiapterin reductase L homeolog
  • sepiapterin reductase b
  • SPR
  • Spr
  • Sptr
  • spr.L
  • sprE
  • CpipJ_CPIJ000511
  • sr
  • spr
  • sprb
Attributs du protein
AA 1-261
6
3
1
1
1
Origine
Humain
9
4
1
1
1
1
1
Source
Escherichia coli (E. coli)
7
5
2
1
1
Type de proteíne
Recombinant
Purification/Conjugué
His tag
Application
Crystallization (Crys), ELISA, SDS-PAGE (SDS), Western Blotting (WB)
Options
Séquence MHHHHHHEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK
Sequence including N-terminal His-tag.
Attributs du produit
  • Made in Germany - from design to production - by highly experienced protein experts.
  • Human SPR Protein (raised in E. Coli) purified by multi-step, protein-specific process to ensure crystallization grade.
  • State-of-the-art algorithm used for plasmid design (Gene synthesis).
Purification Two step purification of proteins expressed in bacterial culture:
  1. In a first purification step, the protein is purified from the cleared cell lysate using three different His-tag capture materials: high yield, EDTA resistant, or DTT resistant. Eluate fractions are analyzed by SDS-PAGE.
  2. Protein containing fractions of the best purification are subjected to second purification step through size exclusion chromatography. Eluate fractions are analyzed by SDS-PAGE and Western blot.
Pureté >95 % as determined by SDS PAGE, Size Exclusion Chromatography and Western Blot.
Stérilité 0.22 μm filtered
niveau d'endotoxine Endotoxin has not been removed. Please contact us if you require endotoxin removal.
Classe de qualité Crystallography grade
Nom de la protéine
Sujet Catalyzes the final one or two reductions in tetra-hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin.
Poids moléculaire 29.0 kDa Including tag.
UniProt P35270
Pathways Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour, Smooth Muscle Cell Migration
Indications d'application In addition to the applications listed above we expect the protein to work for functional studies as well. As the protein has not been tested for functional studies yet we cannot offer a guarantee though.
Commentaires

In cases in which it is highly likely that the recombinant protein with the default tag will be insoluble our protein lab may suggest a higher molecular weight tag (e.g. GST-tag) instead to increase solubility. We will discuss all possible options with you in detail to assure that you receive your protein of interest.

Restrictions For Research Use only
Format Liquid
Buffer 100 mM NaCL, 20 mM Hepes, 10% glycerol. pH value is at the discretion of the manufacturer.
Conseil sur la manipulation Avoid repeated freeze-thaw cycles.
Stock -80 °C
Stockage commentaire Store at -80°C.
Date de péremption Unlimited (if stored properly)
Images (Fournisseur)
 image for Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (ABIN3077209) „Crystallography Grade“ protein due to multi-step, protein-specific purification process
 image for Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (ABIN3077209) Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (Image 2)
 image for Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (ABIN3077209) Sepiapterin Reductase (SPR) (AA 1-261) protein (His tag) (Image 3)
Avez-vous cherché autre chose?