anti-Humain ERCC1 anticorps pour Simple Western

Recommended ERCC1 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Excision Repair Cross Complementing Polypeptide-1 (ERCC1) Anticorps
  • COFS4
  • RAD10
  • UV20
  • Ercc-1
  • ercc1
  • T12H1.18
  • T12H1_18
  • UV REPAIR DEFICIENT 7
  • UVR7
  • ERCC excision repair 1, endonuclease non-catalytic subunit
  • excision repair cross-complementing rodent repair deficiency, complementation group 1
  • DNA excision repair protein ERCC-1
  • nucleotide repair protein
  • excision repair cross-complementation group 1 L homeolog
  • excision repair cross-complementation group 1
  • ERCC1
  • Ercc1
  • CC1G_04546
  • CpipJ_CPIJ013903
  • PITG_13719
  • ercc1
  • ercc1.L
Reactivité
Humain
280
70
56
13
12
12
6
3
3
2
2
2
2
1
1
1
Hôte
Souris
160
96
24
Clonalité
Monoclonal
Conjugué
Cet anticorp ERCC1 est non-conjugé
7
7
6
3
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Simple Western (SimWes), Western Blotting (WB)
246
92
82
78
67
48
41
21
13
5
4
3
3
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4309349
Produit non disponible pour cette région.

General

Antigène Excision Repair Cross Complementing Polypeptide-1 (ERCC1) Anticorps
Reactivité Humain
(280), (70), (56), (13), (12), (12), (6), (3), (3), (2), (2), (2), (2), (1), (1), (1)
Hôte Souris
(160), (96), (24)
Clonalité (Clone)
Monoclonal   ( )
Conjugué Cet anticorp ERCC1 est non-conjugé
(7), (7), (6), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Simple Western (SimWes), Western Blotting (WB)
(246), (92), (82), (78), (67), (48), (41), (21), (13), (5), (4), (3), (3)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-ERCC1 anticorps

Détail du antigène ERCC1 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Protein A purified
Immunogène This antibody was developed against a recombinant protein corresponding to amino acids: LADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
Clone CL1284
Isotype IgG1
Plasmids, Primers & others

Détail du antigène ERCC1

Détail du produit anti-ERCC1 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation ERCC1 (ERCC1 Antibody Extrait)
Sujet Gene Symbol: ERCC1
ID gène 2067
UniProt P07992
Pathways Réparation de l'ADN, Production of Molecular Mediator of Immune Response

Information d'application

Détail du produit anti-ERCC1 anticorps Détail du antigène ERCC1 Stockage Images Haut de la page
Indications d'application Western Blot 1:500 - 1:1000, Simple Western 1:60, Immunohistochemistry 1:200 - 1:500In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-ERCC1 anticorps Détail du antigène ERCC1 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-ERCC1 anticorps Détail du antigène ERCC1 Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunohistochemistry (IHC) image for anti-Excision Repair Cross Complementing Polypeptide-1 (ERCC1) antibody (ABIN4309349) Immunohistochemistry: ERCC1 Antibody (CL1284) [NBP2-34480] - Immunohistochemical stai...
Western Blotting (WB) image for anti-Excision Repair Cross Complementing Polypeptide-1 (ERCC1) antibody (ABIN4309349) Western Blot: ERCC1 Antibody (CL1284) [NBP2-34480] - Lane 1: Marker [kDa]. Lane 2: Hu...
Immunohistochemistry (IHC) image for anti-Excision Repair Cross Complementing Polypeptide-1 (ERCC1) antibody (ABIN4309349) Immunohistochemistry: ERCC1 Antibody (CL1284) [NBP2-34480] - Immunohistochemical stai...
Immunohistochemistry (IHC) image for anti-Excision Repair Cross Complementing Polypeptide-1 (ERCC1) antibody (ABIN4309349) Immunohistochemistry: ERCC1 Antibody (CL1284) [NBP2-34480] - Immunohistochemical stai...
Immunohistochemistry (IHC) image for anti-Excision Repair Cross Complementing Polypeptide-1 (ERCC1) antibody (ABIN4309349) Immunohistochemistry: ERCC1 Antibody (CL1284) [NBP2-34480] - Immunohistochemical stai...
Simple Western (SimWes) image for anti-Excision Repair Cross Complementing Polypeptide-1 (ERCC1) antibody (ABIN4309349) Simple Western: ERCC1 Antibody (CL1284) [NBP2-34480] - Simple Western lane view shows...
Immunohistochemistry (IHC) image for anti-Excision Repair Cross Complementing Polypeptide-1 (ERCC1) antibody (ABIN4309349) Immunohistochemistry: ERCC1 Antibody (CL1284) [NBP2-34480] - Immunohistochemical stai...
Western Blotting (WB) image for anti-Excision Repair Cross Complementing Polypeptide-1 (ERCC1) antibody (ABIN4309349) Western Blot: ERCC1 Antibody (CL1284) - Analysis in U-251MG cells transfected with c...
Western Blotting (WB) image for anti-Excision Repair Cross Complementing Polypeptide-1 (ERCC1) antibody (ABIN4309349) Western Blot: ERCC1 Antibody (CL1284) - Lane 1: Marker Lane 2: Human cell line RT-4