anti-Humain ALAS1 anticorps pour Immunofluorescence

Recommended ALAS1 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Aminolevulinate, delta-, Synthase 1 (ALAS1) Anticorps
  • ALAS
  • ALAS3
  • ALASH
  • MIG4
  • ALAS-N
  • Alas-1
  • Alas-h
  • ALAS-H
  • ALASN
  • ALAS1
  • wu:fb58d01
  • wu:fi12g09
  • 5'-aminolevulinate synthase 1
  • aminolevulinic acid synthase 1
  • alanyl-tRNA synthetase protein
  • aminolevulinate, delta-, synthase 1
  • ALAS1
  • Alas1
  • alas1
  • alas1.S
  • alaS1
Reactivité
Humain, Souris, Rat (Rattus)
70
29
29
2
2
2
2
1
1
1
1
1
Hôte
Lapin
59
14
Clonalité
Polyclonal
Conjugué
Cet anticorp ALAS1 est non-conjugé
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
51
16
13
13
10
9
4
3
2
2
1
1
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4279106
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
10.579316 ABIN2966401 IC IF WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN5949303 ICC IF WB Rabbit IgG C-Term Connectez-vous pour afficher SA70-04 0
1 ABIN6259873 ELISA ICC IF WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN2881738 IF IHC WB Rabbit IgG AA 1-250 Connectez-vous pour afficher Polyclonal 0
1 ABIN4902883 ICC IF WB Rabbit IgG Connectez-vous pour afficher 0
1 ABIN5965211 IF Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN6291751 IF WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN6136753 IF WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN6135513 IF WB Rabbit Connectez-vous pour afficher 0

General

Antigène Aminolevulinate, delta-, Synthase 1 (ALAS1) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(70), (29), (29), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Hôte Lapin
(59), (14)
Clonalité
Polyclonal
Conjugué Cet anticorp ALAS1 est non-conjugé
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(51), (16), (13), (13), (10), (9), (4), (3), (2), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-ALAS1 anticorps

Détail du antigène ALAS1 Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:SQGTASKCPFLAAQMNQRGSSVFCKASLELQEDVQEMNAVRKEVAETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVST
Isotype IgG
Plasmids, Primers & others

Détail du antigène ALAS1

Détail du produit anti-ALAS1 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation Alas1 (ALAS1 Antibody Extrait)
Sujet Gene Symbol: ALAS1
ID gène 211
UniProt P13196
Pathways Regulation of Lipid Metabolism by PPARalpha

Information d'application

Détail du produit anti-ALAS1 anticorps Détail du antigène ALAS1 Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin, HIER pH 6 retrieval method is recommended. IF fixation/permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-ALAS1 anticorps Détail du antigène ALAS1 Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Détail du produit anti-ALAS1 anticorps Détail du antigène ALAS1 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) antibody (ABIN4279106) Western Blot: Alas1 Antibody [NBP1-91656] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunofluorescence (IF) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) antibody (ABIN4279106) Immunocytochemistry/Immunofluorescence: Alas1 Antibody [NBP1-91656] - Immunofluoresce...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) antibody (ABIN4279106) Immunohistochemistry-Paraffin: Alas1 Antibody [NBP1-91656] - Staining of human rectum...
Western Blotting (WB) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) antibody (ABIN4279106) Western Blot: Alas1 Antibody [NBP1-91656] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) antibody (ABIN4279106) Immunohistochemistry-Paraffin: Alas1 Antibody - Staining of human pancreas shows low...
Immunohistochemistry (IHC) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) antibody (ABIN4279106) Immunohistochemistry: Alas1 Antibody - Staining of human adrenal gland shows high ex...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) antibody (ABIN4279106) Immunohistochemistry-Paraffin: Alas1 Antibody - Staining in human adrenal gland and ...