anti-Humain ALAS1 anticorps pour Western Blotting

Recommended ALAS1 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Aminolevulinate, delta-, Synthase 1 (ALAS1) Anticorps
  • ALAS
  • ALAS3
  • ALASH
  • MIG4
  • ALAS-N
  • Alas-1
  • Alas-h
  • ALAS-H
  • ALASN
  • ALAS1
  • wu:fb58d01
  • wu:fi12g09
  • 5'-aminolevulinate synthase 1
  • aminolevulinic acid synthase 1
  • alanyl-tRNA synthetase protein
  • aminolevulinate, delta-, synthase 1
  • ALAS1
  • Alas1
  • alas1
  • alas1.S
  • alaS1
Épitope
N-Term
7
4
4
4
3
2
2
1
1
1
1
1
1
Reactivité
Humain, Souris, Rat (Rattus)
70
29
29
2
2
2
2
1
1
1
1
1
Hôte
Lapin
59
14
Clonalité
Polyclonal
Conjugué
Cet anticorp ALAS1 est non-conjugé
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
51
16
14
13
11
10
4
4
2
2
1
1
Options
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN631001
$ 510.36
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
15.302582 ABIN559839 ELISA WB Mouse IgG2a kappa AA 1-98, partial Connectez-vous pour afficher 3G10 1
13.802582 ABIN396066 ELISA WB Mouse IgG2a kappa AA 1-99 Connectez-vous pour afficher 3G10 0
13.802582 ABIN5996898 IF/ICC WB Rabbit IgG Connectez-vous pour afficher 0
12.754766 ABIN6136754 WB Rabbit Connectez-vous pour afficher Polyclonal 0
12.754766 ABIN6135513 IF WB Rabbit Connectez-vous pour afficher 0
12.754766 ABIN6136753 IF WB Rabbit Connectez-vous pour afficher Polyclonal 0
10.802582 ABIN395524 ELISA WB Mouse IgG2a kappa AA 1-99 Connectez-vous pour afficher 2D5 0
10.802582 ABIN513230 ELISA WB Mouse IgG2a kappa AA 1-98, partial Connectez-vous pour afficher 2D5 0
7.802582 ABIN6259873 ELISA ICC IF WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
7.802582 ABIN5557346 IF (cc) WB Rabbit IgG Connectez-vous pour afficher 1G11 0
7.802582 ABIN2561023 IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
7.802582 ABIN6004338 IF/ICC WB Rabbit IgG full length Connectez-vous pour afficher Polyclonal 0
7.802582 ABIN2966401 IC IF WB Rabbit Connectez-vous pour afficher Polyclonal 0
7 ABIN290712 IHC IHC (p) WB Rabbit IgG AA 480-530 Connectez-vous pour afficher Polyclonal 0
4.802582 ABIN2785663 WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 1
4.802582 ABIN2459736 ELISA WB Rabbit Connectez-vous pour afficher Polyclonal 0
4.802582 ABIN2969414 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.802582 ABIN5965212 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.802582 ABIN2715863 WB Mouse IgG1 AA 57-308 Connectez-vous pour afficher OTI1C5 0
4.802582 ABIN537501 WB Rabbit Connectez-vous pour afficher Polyclonal 0

General

Antigène Aminolevulinate, delta-, Synthase 1 (ALAS1) Anticorps
Épitope N-Term
(7), (4), (4), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivité Humain, Souris, Rat (Rattus)
(70), (29), (29), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Hôte Lapin
(59), (14)
Clonalité
Polyclonal
Conjugué Cet anticorp ALAS1 est non-conjugé
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(51), (16), (14), (13), (11), (10), (4), (4), (2), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-ALAS1 anticorps

Détail du antigène ALAS1 Information d'application Stockage Images
Specificité ALAS1 antibody was raised against the N terminal of ALAS1
Purification Affinity purified
Immunogène ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS
Plasmids, Primers & others

Détail du antigène ALAS1

Détail du produit anti-ALAS1 anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation ALAS1 (ALAS1 Antibody Extrait)
Sujet Delta-aminolevulinate synthase (ALAS, EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2.
Poids moléculaire 70 kDa (MW of target protein)
Pathways Regulation of Lipid Metabolism by PPARalpha

Information d'application

Détail du produit anti-ALAS1 anticorps Détail du antigène ALAS1 Stockage Images Haut de la page
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

ALAS1 Blocking Peptide, catalog no. 33R-2769, is also available for use as a blocking control in assays to test for specificity of this ALAS1 antibody

Restrictions For Research Use only

Stockage

Détail du produit anti-ALAS1 anticorps Détail du antigène ALAS1 Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS1 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Détail du produit anti-ALAS1 anticorps Détail du antigène ALAS1 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) (N-Term) antibody (ABIN631001) ALAS1 antibody used at 1 ug/ml to detect target protein.