anti-Rat (Rattus) ALAS1 anticorps pour Western Blotting

Recommended ALAS1 Antibody (fourni par: Connectez-vous pour afficher )

Aminolevulinate, delta-, Synthase 1 (ALAS1) Anticorps
  • ALAS
  • ALAS3
  • MIG4
  • ALAS-N
  • Alas-1
  • Alas-h
  • ALAS-H
  • ALAS1
  • wu:fb58d01
  • wu:fi12g09
  • 5'-aminolevulinate synthase 1
  • aminolevulinic acid synthase 1
  • alanyl-tRNA synthetase protein
  • aminolevulinate, delta-, synthase 1
  • ALAS1
  • Alas1
  • alas1
  • alas1.S
  • alaS1
Humain, Souris, Rat (Rattus)
Cet anticorp ALAS1 est non-conjugé
Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher


N° du produit ABIN631001
$ 510.36
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
6.124527 ABIN4279106 ICC IF IHC IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.6972427 ABIN2785663 WB Rabbit N-Term Connectez-vous pour afficher Polyclonal 1
4.6972427 ABIN2459736 ELISA WB Rabbit Connectez-vous pour afficher Polyclonal 0
4.6972427 ABIN2969414 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.6972427 ABIN6570493 WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
4.6972427 ABIN6714659 IF WB Rabbit Connectez-vous pour afficher Polyclonal 0
4 ABIN2738227 IHC IHC (p) WB Rabbit IgG AA 146-195 Connectez-vous pour afficher Polyclonal 0
4 ABIN6291751 IF WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1421116 IHC (p) WB HRP Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1403245 IHC (p) WB Biotin Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN1385781 IF (p) IHC (p) WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0
1 ABIN6338993 IF/ICC IHC IP WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN6330753 IF/ICC IHC IP WB Mouse Connectez-vous pour afficher 0


Antigène Aminolevulinate, delta-, Synthase 1 (ALAS1) Anticorps
Épitope N-Term
(7), (4), (4), (4), (3), (1), (1), (1), (1), (1), (1)
Reactivité Humain, Souris, Rat (Rattus)
(73), (30), (30), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Hôte Lapin
(64), (12)
Conjugué Cet anticorp ALAS1 est non-conjugé
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(54), (14), (14), (14), (13), (11), (5), (4), (2), (2), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-ALAS1 anticorps

Détail du antigène ALAS1 Information d'application Stockage Images
Specificité ALAS1 antibody was raised against the N terminal of ALAS1
Purification Affinity purified
Immunogène ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS
Plasmids, Primers & others

Détail du antigène ALAS1

Détail du produit anti-ALAS1 anticorps Information d'application Stockage Images Haut de la page
Autre désignation ALAS1 (ALAS1 Antibody Extrait)
Sujet Delta-aminolevulinate synthase (ALAS, EC catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2.
Poids moléculaire 70 kDa (MW of target protein)
Pathways Regulation of Lipid Metabolism by PPARalpha

Information d'application

Détail du produit anti-ALAS1 anticorps Détail du antigène ALAS1 Stockage Images Haut de la page
Indications d'application WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

ALAS1 Blocking Peptide, catalog no. 33R-2769, is also available for use as a blocking control in assays to test for specificity of this ALAS1 antibody

Restrictions For Research Use only


Détail du produit anti-ALAS1 anticorps Détail du antigène ALAS1 Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS1 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.


Détail du produit anti-ALAS1 anticorps Détail du antigène ALAS1 Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Aminolevulinate, delta-, Synthase 1 (ALAS1) (N-Term) antibody (ABIN631001) ALAS1 antibody used at 1 ug/ml to detect target protein.