anti-Rat (Rattus) FDFT1 anticorps pour Immunofluorescence

Recommended FDFT1 Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) Anticorps
  • FDFT1
  • DKFZp459C1712
  • SQS
  • SS
  • DGPT
  • ERG9
  • fdft1
  • farnesyl-diphosphate farnesyltransferase 1
  • squalene synthase
  • farnesyl diphosphate farnesyl transferase 1
  • FDFT1
  • fdft1
  • LOC100560926
  • Fdft1
Reactivité
Humain, Souris, Rat (Rattus)
108
32
15
4
3
2
2
2
2
1
1
1
Hôte
Lapin
103
17
Clonalité
Polyclonal
Conjugué
Cet anticorp FDFT1 est non-conjugé
11
11
7
6
6
6
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
116
64
60
14
13
9
6
6
4
2
2
Fournisseur
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

Images

N° du produit ABIN4311300
Produit non disponible pour cette région.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
11.344114 ABIN2966630 IC IF WB Rabbit Connectez-vous pour afficher Polyclonal 0
1 ABIN2881552 IF IHC WB Rabbit IgG Connectez-vous pour afficher Polyclonal 0

General

Antigène Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(108), (32), (15), (4), (3), (2), (2), (2), (2), (1), (1), (1)
Hôte Lapin
(103), (17)
Clonalité
Polyclonal
Conjugué Cet anticorp FDFT1 est non-conjugé
(11), (11), (7), (6), (6), (6)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(116), (64), (60), (14), (13), (9), (6), (6), (4), (2), (2)
Pubmed 1 référence disponible
Fournisseur Connectez-vous pour afficher

Détail du produit anti-FDFT1 anticorps

Détail du antigène FDFT1 Information d'application Stockage References for anti-FDFT1 antibody (ABIN4311300) Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
Isotype IgG
Plasmids, Primers & others

Détail du antigène FDFT1

Détail du produit anti-FDFT1 anticorps Information d'application Stockage References for anti-FDFT1 antibody (ABIN4311300) Images Haut de la page
Antigène
Autre désignation FDFT1 (FDFT1 Antibody Extrait)
Sujet Gene Symbol: FDFT1
ID gène 2222
Pathways Regulation of Lipid Metabolism by PPARalpha

Information d'application

Détail du produit anti-FDFT1 anticorps Détail du antigène FDFT1 Stockage References for anti-FDFT1 antibody (ABIN4311300) Images Haut de la page
Indications d'application Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Commentaires

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Stockage

Détail du produit anti-FDFT1 anticorps Détail du antigène FDFT1 Information d'application References for anti-FDFT1 antibody (ABIN4311300) Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-FDFT1 antibody (ABIN4311300)

Détail du produit anti-FDFT1 anticorps Détail du antigène FDFT1 Information d'application Stockage Images Haut de la page
Produit citée dans:

Wu, Hsu, Chen, Yu, Chang, Tai, Liu, Su, Chang, Yu: "Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas." dans: Molecular & cellular proteomics : MCP, Vol. 9, Issue 6, pp. 1100-17, 2010

Images

Détail du produit anti-FDFT1 anticorps Détail du antigène FDFT1 Information d'application Stockage References for anti-FDFT1 antibody (ABIN4311300) Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) antibody (ABIN4311300) Western Blot: FDFT1 Antibody [NBP1-89560] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Western Blotting (WB) image for anti-Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) antibody (ABIN4311300) Western Blot: FDFT1 Antibody [NBP1-89560] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) antibody (ABIN4311300) Immunohistochemistry-Paraffin: FDFT1 Antibody [NBP1-89560] - Staining of human adrena...
Immunofluorescence (IF) image for anti-Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1) antibody (ABIN4311300) Immunocytochemistry/Immunofluorescence: FDFT1 Antibody [NBP1-89560] - Staining of hum...