anti-Rat (Rattus) POLR2H anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended POLR2H Antibody (fourni par: Connectez-vous pour afficher )

Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) Anticorps
  • RPABC3
  • RPB17
  • RPB8
  • POLR2H
  • RGD1561203
  • rpb8
  • rpb17
  • hsrpb8
  • rpabc3
  • zgc:110289
  • RNA polymerase II subunit H
  • polymerase (RNA) II (DNA directed) polypeptide H
  • polymerase (RNA) II subunit H L homeolog
  • polymerase (RNA) II subunit H
  • info polymerase (RNA) II (DNA directed) polypeptide H
  • POLR2H
  • Polr2h
  • polr2h.L
  • polr2h
Humain, Souris, Rat (Rattus)
Cet anticorp POLR2H est non-conjugé
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher


N° du produit ABIN4351017
Produit non disponible pour cette région.


Antigène Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) Anticorps
Reactivité Humain, Souris, Rat (Rattus)
(67), (26), (19), (6), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Hôte Lapin
(63), (5)
Conjugué Cet anticorp POLR2H est non-conjugé
(2), (2), (2), (2), (2), (2)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(65), (25), (12), (9), (7)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-POLR2H anticorps

Détail du antigène POLR2H Information d'application Stockage Images
Specificité Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEY
Isotype IgG
Plasmids, Primers & others

Détail du antigène POLR2H

Détail du produit anti-POLR2H anticorps Information d'application Stockage Images Haut de la page
Autre désignation RPB8 (POLR2H Antibody Extrait)
Sujet Gene Symbol: POLR2H
ID gène 5437
Pathways Regulatory RNA Pathways

Information d'application

Détail du produit anti-POLR2H anticorps Détail du antigène POLR2H Stockage Images Haut de la page
Indications d'application Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Détail du produit anti-POLR2H anticorps Détail du antigène POLR2H Information d'application Images Haut de la page
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Détail du produit anti-POLR2H anticorps Détail du antigène POLR2H Information d'application Stockage Haut de la page
Images (Fournisseur)
Immunofluorescence (IF) image for anti-Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) antibody (ABIN4351017) Immunocytochemistry/Immunofluorescence: RPB8 Antibody [NBP1-80816] - Staining of huma...
Western Blotting (WB) image for anti-Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) antibody (ABIN4351017) Western Blot: RPB8 Antibody [NBP1-80816] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Western Blotting (WB) image for anti-Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) antibody (ABIN4351017) Western Blot: RPB8 Antibody [NBP1-80816] - Lane 1: NIH-3T3 cell lysate (Mouse embryon...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) antibody (ABIN4351017) Immunohistochemistry-Paraffin: RPB8 Antibody [NBP1-80816] - Staining of human stomach...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) antibody (ABIN4351017) Immunohistochemistry-Paraffin: RPB8 Antibody - Staining in human thyroid gland and p...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) antibody (ABIN4351017) Immunohistochemistry-Paraffin: RPB8 Antibody - Staining of human thyroid gland shows...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Polymerase (RNA) II (DNA Directed) Polypeptide H (POLR2H) antibody (ABIN4351017) Immunohistochemistry-Paraffin: RPB8 Antibody - Staining of human pancreas shows low ...