anti-Poisson zèbre (Danio rerio) TAR (HIV-1) RNA Binding Protein 2 anticorps pour Western Blotting

Recommended TAR (HIV-1) RNA Binding Protein 2 Antibody

Antigène
TAR (HIV-1) RNA Binding Protein 2 (TARBP2) Anticorps
  • trbp
  • trbp1
  • trbp2
  • MGC97783
  • TARBP2
  • LOQS
  • TRBP
  • TRBP1
  • TRBP2
  • fj51e12
  • wu:fj51e12
  • zgc:63778
  • Prbp
  • TAR (HIV-1) RNA binding protein 2
  • TARBP2, RISC loading complex RNA binding subunit
  • TAR (HIV-1) RNA binding protein 2 L homeolog
  • TAR (HIV) RNA binding protein 2
  • tarbp2
  • TARBP2
  • tarbp2.L
  • Tarbp2
Reactivité
Humain, Souris, Rat (Rattus), Poisson zèbre (Danio rerio)
73
22
16
8
7
4
3
3
2
2
2
2
1
1
1
1
1
Hôte
Lapin
54
19
Clonalité
Polyclonal
Conjugué
Inconjugué
2
2
2
2
2
2
Application
Western Blotting (WB)
71
38
30
11
6
5
2
1
1
Options

Images

N° du produit ABIN629947
$ 369.29
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Clonality References Details
7 ABIN290382 IHC IHC (p) WB Rabbit AA 150-200 Polyclonal 0
4.857689 ABIN2778885 WB Rabbit N-Term Polyclonal 1
4.857689 ABIN2462162 ELISA WB Rabbit Polyclonal 0
4 ABIN203249 WB Rabbit IgG AA 25-74 Polyclonal 0
4 ABIN372447 IHC (p) WB Rabbit IgG AA 150-200 Polyclonal 0
4 ABIN2470147 IHC WB Rabbit AA 150-200 Polyclonal 0
4 ABIN1739906 IHC (p) WB Rabbit IgG AA 150-200 Polyclonal 0
1 ABIN537303 WB Rabbit Polyclonal 0

General

Antigène TAR (HIV-1) RNA Binding Protein 2 (TARBP2) Anticorps
Reactivité Humain, Souris, Rat (Rattus), Poisson zèbre (Danio rerio)
(73), (22), (16), (8), (7), (4), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Hôte Lapin
(54), (19)
Clonalité
Polyclonal
Conjugué Inconjugué
(2), (2), (2), (2), (2), (2)
Application Western Blotting (WB)
(71), (38), (30), (11), (6), (5), (2), (1), (1)
Fournisseur

Détail du produit

Détail du antigène Information d'application Stockage Images
Purification Purified
Immunogène TARBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCT

Détail du antigène

Détail du produit Information d'application Stockage Images Haut de la page
Antigène
Autre désignation TARBP2 (TARBP2 Antibody Extrait)
Sujet HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARBP2 binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein.
Poids moléculaire 8 kDa (MW of target protein)
Pathways Regulatory RNA Pathways, Ribonucleoprotein Complex Subunit Organization

Information d'application

Détail du produit Détail du antigène Stockage Images Haut de la page
Indications d'application WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.
Commentaires

TARBP2 Blocking Peptide, catalog no. 33R-1405, is also available for use as a blocking control in assays to test for specificity of this TARBP2 antibody

Restrictions For Research Use only

Stockage

Détail du produit Détail du antigène Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TARBP2 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Images

Détail du produit Détail du antigène Information d'application Stockage Haut de la page
Images (Fournisseur)
Western Blotting (WB) image for anti-TAR (HIV-1) RNA Binding Protein 2 (TARBP2) antibody (ABIN629947) TARBP2 antibody used at 2.5 ug/ml to detect target protein.